StarFunc result for job id Q05397

User Input

>input (1052 residues)
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RR02	0.604	0.578	0.000	1101	0.821	0.785	A0A2R8RR02.pdb.gz	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
2	AFDB:E7ESA6	0.686	0.660	0.000	1096	1.000	0.960	E7ESA6.pdb.gz	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
3	AFDB:Q0E917	0.520	0.461	1.462E-76	1200	0.368	0.323	Q0E917.pdb.gz	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
4	AFDB:B7YZL9	0.543	0.391	2.584E-72	1500	0.394	0.276	B7YZL9.pdb.gz	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
5	AFDB:Q06418	0.266	0.311	9.750E-28	890	0.129	0.153	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
6	AFDB:M9MM92	0.249	0.429	3.970E-27	604	0.108	0.189	M9MM92.pdb.gz
7	AFDB:P03949	0.246	0.212	2.004E-25	1224	0.157	0.135	P03949.pdb.gz	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
8	AFDB:Q504U8	0.258	0.249	2.952E-25	1091	0.127	0.123	Q504U8.pdb.gz	Q504U8_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=1
9	AFDB:P42684	0.247	0.221	5.278E-25	1182	0.163	0.146	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
10	AFDB:Q13882	0.242	0.556	1.858E-24	451	0.112	0.262	Q13882.pdb.gz	PTK6_HUMAN Protein-tyrosine kinase 6 OS=Homo sapiens OX=9606 GN=PTK6 PE=1 SV=1
11	PDB:4fl2A	0.235	0.437	2.867E-22	555	0.115	0.218	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:4k2rA	0.231	0.433	2.190E-21	551	0.115	0.220	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:2h8hA	0.229	0.523	2.658E-21	445	0.117	0.276	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:1k9aB	0.235	0.547	1.519E-20	441	0.113	0.270	1k9aB.pdb.gz
15	PDB:4eomC	0.221	0.790	1.292E-14	276	0.066	0.250	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4rerA	0.221	0.490	1.494E-14	459	0.071	0.163	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5ufuA	0.230	0.624	4.333E-14	369	0.070	0.201	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:6b1uA	0.219	0.498	8.534E-14	442	0.065	0.154	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:4rewA	0.226	0.553	9.869E-14	411	0.074	0.190	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:4yc3A	0.212	0.706	1.320E-13	295	0.066	0.234	4yc3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RR02	1720	1101	0.823	0.787	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
2	E1JGM8	642	1198	0.366	0.321	E1JGM8_DROME Focal adhesion kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
3	E7ESA6	2195	1096	1.000	0.960	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
4	G1NJW4	625	393	0.279	0.746	G1NJW4_MELGA Protein kinase domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=3
5	H0YB16	1484	724	0.681	0.989	H0YB16_HUMAN Protein tyrosine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
6	H0YBP1	2076	1017	0.956	0.989	H0YBP1_HUMAN non-specific protein-tyrosine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
7	I6L996	1373	680	0.629	0.974	I6L996_HUMAN PTK2 protein OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
8	O35346	2137	1055	0.970	0.967	FAK1_RAT Focal adhesion kinase 1 OS=Rattus norvegicus OX=10116 GN=Ptk2 PE=1 SV=1
9	P34152	2145	1052	0.973	0.973	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4
10	P70600	843	1009	0.450	0.469	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
11	Q00944	2034	1053	0.940	0.939	FAK1_CHICK Focal adhesion kinase 1 OS=Gallus gallus OX=9031 GN=PTK2 PE=1 SV=2
12	Q05397	2196	1052	1.000	1.000	FAK1_HUMAN Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2
13	Q0E917	645	1200	0.365	0.320	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
14	Q14289	839	1009	0.451	0.470	FAK2_HUMAN Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B PE=1 SV=2
15	Q5BIG9	638	1200	0.363	0.318	Q5BIG9_DROME RE57482p OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
16	Q92063	651	359	0.307	0.900	Q92063_CHICK Protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=FRNK PE=2 SV=1
17	Q98SN4	1738	1050	0.824	0.826	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1
18	Q9QVP9	841	1009	0.450	0.469	FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus OX=10090 GN=Ptk2b PE=1 SV=2
19	Q9U472	645	1200	0.365	0.320	Q9U472_DROME Focal adhesion kinase homolog FAK56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
20	Q9U531	645	1200	0.365	0.320	Q9U531_DROME Focal adhesion kinase homolog DFak56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4e+02	11.5	ABC1 atypical kinase-like domain
2	PF18377 FERM_F2	3.1	19.2	FERM F2 acyl-CoA binding protein-like domain
3	PF00373 FERM_M	4.4e-06	38.4	FERM central domain
4	PF18038 FERM_N_2	1.3e-38	142.9	FERM N-terminal domain
5	PF03623 Focal_AT	1.8e-55	198.0	Focal adhesion targeting region
6	PF12330 Haspin_kinase	7.7	17.0	Haspin like kinase domain
7	PF14531 Kinase-like	3.3	18.6	Kinase-like
8	PF00069 Pkinase	1.7e-42	157.2	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	9.4e-91	315.2	Protein tyrosine and serine/threonine kinase
10	PF17085 UCMA	5.1e+02	12.1	Unique cartilage matrix associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000002703

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000004158	0.998	Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion).
2	9555.ENSPANP00000006407	0.997	BCAR1, Cas family scaffolding protein
3	9555.ENSPANP00000016119	0.995	Growth factor receptor-bound protein 2
4	9555.ENSPANP00000017765	0.988	Tyrosine-protein kinase
5	9555.ENSPANP00000020539	0.987	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
6	9555.ENSPANP00000020121	0.985	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
7	9555.ENSPANP00000001366	0.984	Phosphoinositide-3-kinase regulatory subunit 1 alpha
8	9555.ENSPANP00000019472	0.984	CRK proto-oncogene, adaptor protein
9	9555.ENSPANP00000020867	0.983	Belongs to the integrin beta chain family.
10	9555.ENSPANP00000011059	0.975	DCC netrin 1 receptor
11	9555.ENSPANP00000006832	0.967	Belongs to the integrin alpha chain family.
12	9555.ENSPANP00000003878	0.966	Receptor protein-tyrosine kinase
13	9555.ENSPANP00000005005	0.964	Tyrosine-protein kinase
14	9555.ENSPANP00000020554	0.961	Receptor protein-tyrosine kinase
15	9555.ENSPANP00000012723	0.960	Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
16	9555.ENSPANP00000010633	0.957	Fibronectin 1
17	9555.ENSPANP00000012594	0.949	Transforming growth factor beta 1 induced transcript 1
18	9555.ENSPANP00000017299	0.948	FYN proto-oncogene, Src family tyrosine kinase
19	9555.ENSPANP00000004416	0.944	LYN proto-oncogene, Src family tyrosine kinase
20	9555.ENSPANP00000008565	0.944	Belongs to the integrin beta chain family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019899	0.894	enzyme binding
GO:0005102	0.796	signaling receptor binding
GO:0050839	0.758	cell adhesion molecule binding
GO:0044877	0.718	protein-containing complex binding
GO:0004715	0.652	non-membrane spanning protein tyrosine kinase activity
GO:0098772	0.433	molecular function regulator activity
GO:0005178	0.428	integrin binding
GO:0019901	0.346	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.977	biological regulation
GO:0009987	0.977	cellular process
GO:0050896	0.971	response to stimulus
GO:0050794	0.969	regulation of cellular process
GO:0048518	0.954	positive regulation of biological process
GO:0009653	0.939	anatomical structure morphogenesis
GO:0032501	0.927	multicellular organismal process
GO:0007154	0.905	cell communication
GO:0007165	0.899	signal transduction
GO:0018108	0.886	peptidyl-tyrosine phosphorylation
GO:0007275	0.885	multicellular organism development
GO:0019222	0.829	regulation of metabolic process
GO:0048519	0.798	negative regulation of biological process
GO:0048522	0.775	positive regulation of cellular process
GO:0030154	0.770	cell differentiation
GO:0048523	0.677	negative regulation of cellular process
GO:0051239	0.671	regulation of multicellular organismal process
GO:0050793	0.655	regulation of developmental process
GO:0007166	0.632	cell surface receptor signaling pathway
GO:0031323	0.596	regulation of cellular metabolic process
GO:0071840	0.593	cellular component organization or biogenesis
GO:0048731	0.585	system development
GO:0048583	0.555	regulation of response to stimulus
GO:0016043	0.547	cellular component organization
GO:0042221	0.532	response to chemical
GO:0009966	0.532	regulation of signal transduction
GO:0080090	0.519	regulation of primary metabolic process
GO:0060255	0.515	regulation of macromolecule metabolic process
GO:0051171	0.513	regulation of nitrogen compound metabolic process
GO:0000902	0.504	cell morphogenesis
GO:0065008	0.497	regulation of biological quality
GO:0009893	0.496	positive regulation of metabolic process
GO:0010604	0.463	positive regulation of macromolecule metabolic process
GO:0030334	0.440	regulation of cell migration
GO:0051174	0.431	regulation of phosphorus metabolic process
GO:0051128	0.429	regulation of cellular component organization
GO:2000147	0.425	positive regulation of cell motility
GO:0065009	0.411	regulation of molecular function
GO:0009888	0.407	tissue development
GO:0048468	0.406	cell development
GO:0035295	0.404	tube development
GO:0048584	0.367	positive regulation of response to stimulus
GO:0030155	0.355	regulation of cell adhesion
GO:0007399	0.324	nervous system development
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0019220	0.313	regulation of phosphate metabolic process
GO:0051246	0.312	regulation of protein metabolic process
GO:0051173	0.306	positive regulation of nitrogen compound metabolic process
GO:2000026	0.303	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070161	0.996	anchoring junction
GO:0005925	0.991	focal adhesion
GO:0071944	0.986	cell periphery
GO:0016020	0.985	membrane
GO:0005886	0.981	plasma membrane
GO:0005829	0.976	cytosol
GO:0005634	0.934	nucleus
GO:0120025	0.501	plasma membrane bounded cell projection
GO:0043228	0.374	non-membrane-bounded organelle
GO:0043232	0.354	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.652	non-specific protein-tyrosine kinase.

[back to server]