StarFunc result for job id Q05469

User Input

>input (1076 residues)
MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQ
QETPAQHDAESQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLG
KESITQQEPALRQRHVAQPGPGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQET
PEQSDKQTTPVQGAKSKQGSLTELGFLTKLQELSIQRSALEWKALSEWVTDSESESDVGS
SSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPHEKTSARNHRHYQDTASRLIH
NMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEPALGRLLGVAH
LFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRP
FLQTISIGLVSFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWK
AFWNITEMEVLSSLANMASATVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGP
VLVRLISYDLREGQDSEELSSLIKSNGQRSLELWPRPQQAPRSRSLIVHFHGGGFVAQTS
RSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFFAYCWAIKHCALLGSTGERIC
LAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVL
SKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAET
LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLY
SSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVE
DLPHGFLTLAALCRETRQAAELCVERIRLVLTPPAGAGPSGETGAAGVDGGCGGRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15304	0.666	0.671	0.000	1068	0.717	0.722	P15304.pdb.gz	LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus OX=10116 GN=Lipe PE=1 SV=3
2	AFDB:Q05469	1.000	1.000	0.000	1076	1.000	1.000	Q05469.pdb.gz	LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens OX=9606 GN=LIPE PE=1 SV=4
3	PDB:5l2pA	0.225	0.732	1.269E-11	306	0.077	0.271	5l2pA.pdb.gz
4	PDB:4kryE	0.229	0.708	1.457E-11	329	0.072	0.237	4kryE.pdb.gz
5	PDB:3aikA	0.240	0.860	9.201E-11	283	0.069	0.261	3aikA.pdb.gz
6	PDB:2zsiA	0.221	0.652	4.408E-10	339	0.071	0.224	2zsiA.pdb.gz	Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
7	PDB:3eblA	0.208	0.645	1.334E-8	323	0.072	0.241	3eblA.pdb.gz	Structural basis for gibberellin recognition by its receptor GID1.
8	PDB:6rs4A	0.112	0.358	1.165E-6	315	0.038	0.130	6rs4A.pdb.gz
9	PDB:6rt8A	0.114	0.378	4.234E-6	314	0.037	0.127	6rt8A.pdb.gz	Structural basis of cycloaddition in biosynthesis of iboga and aspidosperma alkaloids.
10	PDB:4bzwA	0.119	0.411	1.611E-5	275	0.036	0.142	4bzwA.pdb.gz	Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
11	PDB:4e15B	0.114	0.355	6.131E-5	303	0.031	0.109	4e15B.pdb.gz
12	PDB:5thmA	0.117	0.231	6.722E-5	520	0.029	0.060	5thmA.pdb.gz	Molecular basis for the behavioral effects of the odorant degrading enzyme Esterase 6 in Drosophila.
13	AFDB:G5E870	0.076	0.051	1.450E-4	2025	0.125	0.067	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
14	AFDB:Q14669	0.069	0.051	2.769E-3	1992	0.127	0.069	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
15	AFDB:A0A0B4LF79	0.048	0.051	3.179E-3	1000	0.106	0.114	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
16	AFDB:D3DTR7	0.093	0.110	1.103E-2	841	0.104	0.133	D3DTR7.pdb.gz
17	AFDB:O14029	0.068	0.046	2.904E-2	1995	0.108	0.058	O14029.pdb.gz	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
18	AFDB:A0A0K3AU72	0.065	0.054	4.603E-2	1698	0.120	0.076	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
19	AFDB:A0A1D8PLA4	0.050	0.048	4.603E-2	1196	0.092	0.083	A0A1D8PLA4.pdb.gz	A0A1D8PLA4_CANAL Zcf27p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF27 PE=4 SV=1
20	AFDB:O15013	0.070	0.059	4.603E-2	1369	0.093	0.073	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15304	0.0	1496	1068	0.719	0.725	LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus OX=10116 GN=Lipe PE=1 SV=3
2	P54310	0.0	1319	759	0.601	0.852	LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus OX=10090 GN=Lipe PE=1 SV=2
3	Q05469	0.0	2195	1076	1.000	1.000	LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens OX=9606 GN=LIPE PE=1 SV=4
4	M0QYP8	5.21e-155	462	260	0.210	0.869	M0QYP8_HUMAN Lipase E, hormone sensitive type (Fragment) OS=Homo sapiens OX=9606 GN=LIPE PE=1 SV=1
5	M0R2G1	4.21e-152	453	222	0.203	0.982	M0R2G1_HUMAN Lipase E, hormone sensitive type (Fragment) OS=Homo sapiens OX=9606 GN=LIPE PE=1 SV=1
6	M0QXM5	2.38e-120	368	176	0.164	1.000	M0QXM5_HUMAN Lipase E, hormone sensitive type (Fragment) OS=Homo sapiens OX=9606 GN=LIPE PE=1 SV=1
7	Q7JR83	1.22e-102	345	881	0.185	0.226	Q7JR83_DROME Hormone-sensitive lipase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hsl PE=1 SV=1
8	Q960T4	6.29e-52	193	507	0.083	0.176	Q960T4_DROME LD36294p OS=Drosophila melanogaster OX=7227 GN=Hsl PE=2 SV=1
9	P9WK87	3.71e-14	77.0	319	0.046	0.154	NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nlhH PE=1 SV=1
10	Q9HTI0	1.37e-13	75.5	331	0.049	0.160	Q9HTI0_PSEAE Probable lipolytic enzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5384 PE=4 SV=1
11	P95125	1.58e-11	69.7	376	0.032	0.090	LIPN_MYCTU Carboxylic ester hydrolase LipN OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipN PE=1 SV=1
12	B5BLW5	1.96e-11	68.6	306	0.032	0.111	ARE_SACSO Arylesterase OS=Saccharolobus solfataricus OX=2287 GN=are PE=1 SV=1
13	Q976W8	3.01e-10	65.1	303	0.035	0.125	Q976W8_SULTO Carboxylesterase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=ST0071 PE=1 SV=1
14	C4ZUT0	6.45e-10	64.3	319	0.033	0.110	AES_ECOBW Acetyl esterase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=aes PE=3 SV=1
15	P23872	6.45e-10	64.3	319	0.033	0.110	AES_ECOLI Acetyl esterase OS=Escherichia coli (strain K12) OX=83333 GN=aes PE=1 SV=3
16	Q5NUF4	1.27e-09	63.5	328	0.038	0.125	HIDM_GLYEC 2-hydroxyisoflavanone dehydratase OS=Glycyrrhiza echinata OX=46348 GN=HIDM PE=1 SV=1
17	Q6PIU2	2.28e-09	63.2	408	0.048	0.127	NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 OS=Homo sapiens OX=9606 GN=NCEH1 PE=1 SV=3
18	Q4WB49	2.46e-09	62.4	323	0.033	0.111	Q4WB49_ASPFU Lipase/esterase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G01050 PE=4 SV=1
19	Q9SMM9	2.48e-09	62.4	329	0.033	0.106	CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana OX=3702 GN=CXE13 PE=1 SV=1
20	Q9LT10	4.44e-09	61.6	335	0.040	0.128	CXE18_ARATH Probable carboxylesterase 18 OS=Arabidopsis thaliana OX=3702 GN=CXE18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07859 Abhydrolase_3	5.6e-44	162.1	alpha/beta hydrolase fold
2	PF20434 BD-FAE	1.1e-08	46.4	BD-FAE
3	PF06350 HSL_N	1e-112	387.7	Hormone-sensitive lipase (HSL) N-terminus
4	PF08799 PRP4	5.2e+02	11.6	pre-mRNA processing factor 4 (PRP4) like
5	PF10340 Say1_Mug180	0.095	23.2	Steryl acetyl hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256104	0.998	Fatty acid-binding protein, adipocyte
2	9606.ENSP00000300055	0.997	Perilipin-1
3	9606.ENSP00000337701	0.995	Patatin-like phospholipase domain-containing protein 2
4	9606.ENSP00000216180	0.980	Patatin-like phospholipase domain-containing protein 3
5	9606.ENSP00000370430	0.976	Patatin-like phospholipase domain-containing protein 4
6	9606.ENSP00000377900	0.961	Lipase F, gastric type
7	9606.ENSP00000299022	0.959	Hepatic triacylglycerol lipase
8	9606.ENSP00000358223	0.959	Pancreatic lipase
9	9606.ENSP00000358232	0.955	Pancreatic lipase related protein 3
10	9606.ENSP00000361151	0.945	Bile salt-activated lipase
11	9606.ENSP00000261292	0.937	Endothelial lipase
12	9606.ENSP00000309591	0.935	cAMP-dependent protein kinase catalytic subunit alpha
13	9606.ENSP00000359719	0.918	cAMP-dependent protein kinase catalytic subunit beta
14	9606.ENSP00000366488	0.915	cAMP-dependent protein kinase catalytic subunit gamma
15	9606.ENSP00000390849	0.892	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
16	9606.ENSP00000297258	0.882	Fatty acid-binding protein, epidermal
17	9606.ENSP00000349541	0.857	Caveolae-associated protein 1
18	9606.ENSP00000309757	0.850	Lipoprotein lipase
19	9606.ENSP00000482264	0.850	Diacylglycerol O-acyltransferase 1
20	9606.ENSP00000360290	0.842	5'-AMP-activated protein kinase catalytic subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050253	1.000	retinyl-palmitate esterase activity
GO:0004806	1.000	triglyceride lipase activity
GO:0004771	1.000	sterol esterase activity
GO:0033878	0.942	hormone-sensitive lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:1901564	0.973	organonitrogen compound metabolic process
GO:0006796	0.925	phosphate-containing compound metabolic process
GO:0043170	0.886	macromolecule metabolic process
GO:0016310	0.750	phosphorylation
GO:0006468	0.671	protein phosphorylation
GO:0006629	0.644	lipid metabolic process
GO:0044281	0.483	small molecule metabolic process
GO:0050896	0.422	response to stimulus
GO:0044255	0.307	cellular lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.956	intracellular organelle
GO:0016020	0.852	membrane
GO:0043232	0.765	intracellular non-membrane-bounded organelle
GO:0005811	0.565	lipid droplet
GO:0043231	0.490	intracellular membrane-bounded organelle
GO:0005576	0.403	extracellular region
GO:0005615	0.372	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21508	1.000	all-trans-retinyl hexadecanoate + H2O = H(+) + hexadecanoate + retinol
EC:3.1.1.21	1.000	Deleted entry.
RHEA:12044	1.000	a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+)
RHEA:10100	1.000	a sterol ester + H2O = a fatty acid + a sterol + H(+)
EC:3.1.1.3	1.000	triacylglycerol lipase.
EC:3.1.1.13	1.000	sterol esterase.
EC:3.1.1.79	0.942	hormone-sensitive lipase.

[back to server]