StarFunc result for job id Q05481

User Input

>input (1191 residues)
MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPD
LITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENL
QLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKK
CFKCKKCVKSFCIRLHKTQHKCVYITEKSCKCKECEKTFHWSSTLTNHKEIHTEDKPYKC
EECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECG
KAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFS
NSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSN
LTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRH
KRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIH
SREKPYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEK
SYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKC
KECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECG
KAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFI
WSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSA
LAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEH
KRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIH
TGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEK
PYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKC
EECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKPYKCEKCG
KAFNQSSILTNHKKIHTITPVIPLLWEAEAGGSRGQEMETILANTVKPLLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	1.000	1.000	0.000	1191	1.000	1.000	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:Q9UII5	0.302	0.431	1.092E-76	783	0.458	0.696	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
3	AFDB:A6NNF4	0.264	0.368	5.093E-76	738	0.472	0.762	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q5DTF8	0.292	0.369	1.537E-74	919	0.410	0.531	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
5	AFDB:P17038	0.280	0.379	8.251E-74	809	0.462	0.680	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
6	AFDB:Q14587	0.249	0.297	3.245E-71	947	0.366	0.460	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:Q9P2J8	0.258	0.328	4.361E-69	865	0.340	0.468	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:A0A1B0GR71	0.332	0.397	1.514E-67	966	0.357	0.440	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
9	AFDB:Q6ZR52	0.219	0.379	1.742E-64	646	0.385	0.709	Q6ZR52.pdb.gz	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
10	AFDB:Q5TYW1	0.256	0.278	5.340E-64	1059	0.386	0.434	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
11	PDB:3w5kB	0.049	0.269	2.559E-3	110	0.034	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5ijnC	0.068	0.103	7.604E-1	636	0.052	0.097	5ijnC.pdb.gz
13	PDB:5fj9O	0.065	0.103	1.395	528	0.047	0.106	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
14	PDB:7wooZ	0.094	0.123	1.395	746	0.063	0.101	7wooZ.pdb.gz
15	PDB:7o4i1	0.050	0.076	2.026	522	0.052	0.119	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:5c8dE	0.042	0.111	2.225	280	0.018	0.075	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:7ena4	0.046	0.080	2.225	457	0.041	0.107	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:5oqj2	0.044	0.084	3.548	395	0.031	0.094	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
19	PDB:6hivDD	0.054	0.071	3.717	791	0.065	0.097	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7cunA	0.063	0.087	3.895	730	0.032	0.052	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	551	609	0.243	0.475	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A0A1B0GR71	592	966	0.277	0.342	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	A0A8I6G8Y2	578	723	0.239	0.394	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
4	A6NNF4	591	616	0.269	0.519	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	A8K8Y5	564	707	0.234	0.395	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	F8WEC7	558	859	0.262	0.363	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
7	G3V9G6	578	740	0.239	0.385	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
8	O75290	550	641	0.228	0.424	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
9	O75437	1029	659	0.437	0.789	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
10	P15620	546	580	0.231	0.474	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
11	P17020	552	682	0.237	0.413	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
12	P17027	548	643	0.229	0.425	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
13	P17038	1037	809	0.462	0.680	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
14	P17097	555	686	0.276	0.480	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
15	P35789	611	620	0.271	0.521	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
16	P51523	558	738	0.252	0.407	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
17	P51814	556	821	0.247	0.358	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
18	P52742	548	658	0.233	0.422	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
19	Q02386	549	682	0.238	0.415	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
20	Q03923	555	595	0.252	0.504	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	0.82	21.4	BolA-like protein
2	PF04814 HNF-1_N	3.4	19.5	Hepatocyte nuclear factor 1 (HNF-1), N terminus
3	PF07754 HVO_2753_ZBP	0.0045	28.1	Small zinc finger protein HVO_2753-like, Zn-binding pocket
4	PF01352 KRAB	1.1e-19	81.1	KRAB box
5	PF10484 MRP-S23	35	16.1	Mitochondrial ribosomal protein S23
6	PF01286 XPA_N	4.3e-38	140.3	XPA protein N-terminal
7	PF00096 zf-C2H2	7.3e-166	541.2	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	7.4e-30	113.7	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	3.1e-81	271.9	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	3.4e-44	159.3	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	1.9e-59	208.1	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	1.3e-238	773.4	Zinc-finger double domain
13	PF02591 zf-RING_7	0.00014	33.3	C4-type zinc ribbon domain
14	PF13451 zf-trcl	0.0067	27.6	Probable zinc-ribbon domain
15	PF18439 zf_UBZ	3.6e-27	105.0	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	0.022	26.8	zinc-ribbon family
17	PF09723 Zn-ribbon_8	8.1e-23	91.6	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	4.9e-10	50.5	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300619

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432561	0.923	Histatin-3
2	9606.ENSP00000263805	0.768	Zinc finger protein 106
3	9606.ENSP00000253024	0.543	Transcription intermediary factor 1-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.794	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048519	0.967	negative regulation of biological process
GO:0010468	0.964	regulation of gene expression
GO:0048523	0.947	negative regulation of cellular process
GO:0045892	0.943	negative regulation of DNA-templated transcription
GO:0009987	0.630	cellular process
GO:0050896	0.362	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.978	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]