StarFunc result for job id Q05513

User Input

>input (592 residues)
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09217	0.899	0.899	0.000	592	0.959	0.959	P09217.pdb.gz	KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus OX=10116 GN=Prkcz PE=1 SV=2
2	AFDB:B0S4T7	0.619	0.611	1.303E-94	599	0.818	0.808	B0S4T7.pdb.gz
3	AFDB:F1M7Y5	0.842	0.837	4.251E-91	596	0.730	0.725	F1M7Y5.pdb.gz	KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus OX=10116 GN=Prkci PE=1 SV=1
4	AFDB:Q90XF2	0.688	0.692	1.629E-87	588	0.709	0.714	Q90XF2.pdb.gz	KPCI_DANRE Protein kinase C iota type OS=Danio rerio OX=7955 GN=prkci PE=2 SV=2
5	AFDB:A1Z9X0	0.855	0.836	7.727E-85	606	0.633	0.619	A1Z9X0.pdb.gz	APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster OX=7227 GN=aPKC PE=1 SV=1
6	AFDB:Q19266	0.755	0.749	3.705E-74	597	0.568	0.563	Q19266.pdb.gz	KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans OX=6239 GN=pkc-3 PE=1 SV=1
7	AFDB:L7RTI5	0.563	0.454	9.507E-51	737	0.363	0.292	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
8	AFDB:B8A467	0.579	0.468	2.929E-50	738	0.389	0.312	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
9	AFDB:H9G2Y7	0.550	0.428	2.929E-50	763	0.372	0.288	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
10	AFDB:P13678	0.552	0.443	7.293E-49	739	0.353	0.283	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
11	PDB:3pfqA	0.528	0.596	5.524E-37	523	0.294	0.333	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.499	0.721	9.543E-29	405	0.201	0.294	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:3nynA	0.485	0.516	2.249E-28	554	0.196	0.209	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
14	PDB:3c4wB	0.500	0.567	2.503E-28	519	0.193	0.220	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:6pjxA	0.499	0.542	8.585E-28	543	0.182	0.199	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
16	PDB:3pvuA	0.485	0.472	1.064E-27	609	0.166	0.161	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:4yhjA	0.501	0.587	1.318E-27	501	0.182	0.216	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
18	PDB:6s9wA	0.430	0.605	1.318E-27	411	0.235	0.338	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:5x3fB	0.447	0.742	1.818E-27	349	0.193	0.327	5x3fB.pdb.gz
20	PDB:4mk0A	0.495	0.465	6.233E-27	631	0.166	0.155	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z9X0	0.0	764	606	0.633	0.619	APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster OX=7227 GN=aPKC PE=1 SV=1
2	F1M7Y5	0.0	888	596	0.723	0.718	KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus OX=10116 GN=Prkci PE=1 SV=1
3	P09217	0.0	1180	592	0.959	0.959	KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus OX=10116 GN=Prkcz PE=1 SV=2
4	P41743	0.0	884	596	0.725	0.720	KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2
5	Q02956	0.0	1176	592	0.956	0.956	KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus OX=10090 GN=Prkcz PE=1 SV=2
6	Q05513	0.0	1231	592	1.000	1.000	KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4
7	Q19266	0.0	673	597	0.566	0.561	KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans OX=6239 GN=pkc-3 PE=1 SV=1
8	Q4JG04	0.0	1018	599	0.818	0.808	Q4JG04_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-150o23.4 PE=2 SV=1
9	Q62074	0.0	888	595	0.723	0.719	KPCI_MOUSE Protein kinase C iota type OS=Mus musculus OX=10090 GN=Prkci PE=1 SV=3
10	Q90XF2	0.0	865	588	0.709	0.714	KPCI_DANRE Protein kinase C iota type OS=Danio rerio OX=7955 GN=prkci PE=2 SV=2
11	P34885	1.08e-135	413	707	0.380	0.318	KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=2
12	H9G2Y7	6.34e-135	413	763	0.380	0.295	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
13	B8A467	1.09e-131	404	738	0.372	0.298	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
14	P16054	5.98e-131	402	737	0.370	0.297	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
15	L7RTI5	2.65e-130	400	737	0.367	0.294	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
16	Q02156	2.65e-130	400	737	0.367	0.294	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
17	P13678	4.94e-130	400	739	0.355	0.284	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
18	P09216	1.98e-129	398	737	0.370	0.297	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
19	P23298	1.64e-125	386	683	0.338	0.293	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
20	Q64617	3.02e-125	385	683	0.338	0.293	KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus OX=10116 GN=Prkch PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.3	17.6	ABC1 atypical kinase-like domain
2	PF01636 APH	56	15.0	Phosphotransferase enzyme family
3	PF00130 C1_1	2.1e-11	54.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	14	17.4	C1 domain
5	PF13095 FTA2	1.9e+02	13.1	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	2.8e+02	12.3	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	0.5	21.2	Kinase-like
8	PF00564 PB1	2.4e-15	67.6	PB1 domain
9	PF00069 Pkinase	7.3e-61	217.4	Protein kinase domain
10	PF00433 Pkinase_C	0.018	27.0	Protein kinase C terminal domain
11	PF07714 PK_Tyr_Ser-Thr	6.3e-30	115.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367830

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219255	0.999	Partitioning defective 6 homolog alpha
2	9606.ENSP00000374455	0.998	Sequestosome-1
3	9606.ENSP00000383118	0.998	Cell division control protein 42 homolog
4	9606.ENSP00000343144	0.996	Partitioning defective 6 homolog gamma
5	9606.ENSP00000328088	0.995	PRKC apoptosis WT1 regulator protein
6	9606.ENSP00000360672	0.995	Partitioning defective 6 homolog beta
7	9606.ENSP00000262971	0.991	E3 SUMO-protein ligase PIAS4
8	9606.ENSP00000289473	0.991	Neutrophil cytosol factor 1
9	9606.ENSP00000321537	0.991	Lethal(2) giant larvae protein homolog 1
10	9606.ENSP00000363921	0.990	Partitioning defective 3 homolog
11	9606.ENSP00000451828	0.987	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000433623	0.985	TNF receptor-associated factor 6
13	9606.ENSP00000451300	0.985	Protein numb homolog
14	9606.ENSP00000344220	0.981	3-phosphoinositide-dependent protein kinase 1
15	9606.ENSP00000376333	0.978	Lethal(2) giant larvae protein homolog 2
16	9606.ENSP00000384273	0.978	Transcription factor p65
17	9606.ENSP00000286827	0.974	T-lymphoma invasion and metastasis-inducing protein 1
18	9606.ENSP00000295797	0.974	Protein kinase C iota type
19	9606.ENSP00000324806	0.972	Glycogen synthase kinase-3 beta
20	9606.ENSP00000362680	0.968	Proto-oncogene tyrosine-protein kinase Src

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0004697	0.985	protein kinase C activity
GO:0019899	0.892	enzyme binding
GO:0019900	0.825	kinase binding
GO:0098772	0.798	molecular function regulator activity
GO:0019901	0.680	protein kinase binding
GO:0097159	0.564	organic cyclic compound binding
GO:1901363	0.562	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0006796	0.979	phosphate-containing compound metabolic process
GO:0016310	0.961	phosphorylation
GO:0071704	0.959	organic substance metabolic process
GO:0048518	0.951	positive regulation of biological process
GO:0043170	0.935	macromolecule metabolic process
GO:1901564	0.917	organonitrogen compound metabolic process
GO:0048522	0.913	positive regulation of cellular process
GO:0019538	0.903	protein metabolic process
GO:0036211	0.893	protein modification process
GO:0019222	0.892	regulation of metabolic process
GO:0051716	0.873	cellular response to stimulus
GO:0023052	0.865	signaling
GO:0007154	0.860	cell communication
GO:0080090	0.818	regulation of primary metabolic process
GO:0051171	0.816	regulation of nitrogen compound metabolic process
GO:0032501	0.811	multicellular organismal process
GO:0031323	0.807	regulation of cellular metabolic process
GO:0060255	0.801	regulation of macromolecule metabolic process
GO:0007165	0.800	signal transduction
GO:0006468	0.793	protein phosphorylation
GO:0048583	0.773	regulation of response to stimulus
GO:0009893	0.763	positive regulation of metabolic process
GO:0048519	0.747	negative regulation of biological process
GO:0071840	0.659	cellular component organization or biogenesis
GO:0023051	0.659	regulation of signaling
GO:0010646	0.658	regulation of cell communication
GO:0010468	0.647	regulation of gene expression
GO:0010604	0.630	positive regulation of macromolecule metabolic process
GO:0032502	0.614	developmental process
GO:0048523	0.606	negative regulation of cellular process
GO:0051239	0.591	regulation of multicellular organismal process
GO:0051246	0.539	regulation of protein metabolic process
GO:0048584	0.515	positive regulation of response to stimulus
GO:0048856	0.509	anatomical structure development
GO:0016043	0.506	cellular component organization
GO:0009966	0.504	regulation of signal transduction
GO:0031325	0.498	positive regulation of cellular metabolic process
GO:1902531	0.494	regulation of intracellular signal transduction
GO:0051173	0.481	positive regulation of nitrogen compound metabolic process
GO:0031326	0.478	regulation of cellular biosynthetic process
GO:0042221	0.467	response to chemical
GO:0044093	0.467	positive regulation of molecular function
GO:0051179	0.466	localization
GO:0010556	0.462	regulation of macromolecule biosynthetic process
GO:0070887	0.457	cellular response to chemical stimulus
GO:0051252	0.456	regulation of RNA metabolic process
GO:0006355	0.446	regulation of DNA-templated transcription
GO:0010033	0.445	response to organic substance
GO:0051247	0.434	positive regulation of protein metabolic process
GO:0010941	0.418	regulation of cell death
GO:0071310	0.414	cellular response to organic substance
GO:0006950	0.401	response to stress
GO:0051174	0.376	regulation of phosphorus metabolic process
GO:0007166	0.359	cell surface receptor signaling pathway
GO:0019220	0.356	regulation of phosphate metabolic process
GO:0031399	0.355	regulation of protein modification process
GO:0009967	0.339	positive regulation of signal transduction
GO:0050793	0.333	regulation of developmental process
GO:0032879	0.323	regulation of localization
GO:0051128	0.321	regulation of cellular component organization
GO:0035556	0.300	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043226	0.987	organelle
GO:0005829	0.979	cytosol
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005576	0.871	extracellular region
GO:0031982	0.861	vesicle
GO:0005615	0.816	extracellular space
GO:0030054	0.798	cell junction
GO:1903561	0.659	extracellular vesicle
GO:0070062	0.579	extracellular exosome
GO:0032991	0.557	protein-containing complex
GO:0005911	0.480	cell-cell junction
GO:0005634	0.452	nucleus
GO:0043232	0.391	intracellular non-membrane-bounded organelle
GO:0043296	0.340	apical junction complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.13	0.985	protein kinase C.

[back to server]