StarFunc result for job id Q05516

User Input

>input (673 residues)
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05516	1.000	1.000	0.000	673	1.000	1.000	Q05516.pdb.gz	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
2	AFDB:Q802Y8	0.549	0.550	1.750E-81	671	0.795	0.797	Q802Y8.pdb.gz	ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio OX=7955 GN=zbtb16a PE=1 SV=1
3	AFDB:E7FGS1	0.592	0.603	1.476E-78	659	0.712	0.727	E7FGS1.pdb.gz	E7FGS1_DANRE Zinc finger and BTB domain-containing 16b OS=Danio rerio OX=7955 GN=zbtb16b PE=1 SV=1
4	AFDB:Q14587	0.229	0.167	9.207E-26	947	0.195	0.138	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	AFDB:Q15776	0.241	0.279	6.488E-24	578	0.232	0.270	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	AFDB:Q02975	0.226	0.261	1.104E-23	576	0.172	0.201	Q02975.pdb.gz	Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus OX=10116 GN=Znf354a PE=2 SV=1
7	AFDB:Q6NX49	0.232	0.219	2.381E-23	715	0.214	0.201	Q6NX49.pdb.gz	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
8	AFDB:Q9H5H4	0.152	0.186	9.270E-23	540	0.195	0.243	Q9H5H4.pdb.gz	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
9	AFDB:Q9HBT8	0.234	0.297	9.834E-23	521	0.166	0.215	Q9HBT8.pdb.gz	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
10	AFDB:Q8IYX0	0.236	0.376	5.791E-22	411	0.152	0.248	Q8IYX0.pdb.gz	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
11	PDB:3w5kB	0.075	0.264	3.105E-4	110	0.056	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2p1nD	0.084	0.280	5.015E-1	127	0.031	0.165	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
13	PDB:6gejS	0.051	0.108	5.988E-1	208	0.052	0.168	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:4n78F	0.061	0.219	9.608E-1	156	0.028	0.122	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
15	PDB:5apnp	0.037	0.171	1.019	91	0.019	0.143	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7rdqD	0.047	0.032	1.735	1366	0.036	0.018	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
17	PDB:4p1mB	0.060	0.321	2.473	107	0.018	0.112	4p1mB.pdb.gz
18	PDB:5x22D	0.063	0.035	2.784	1438	0.019	0.009	5x22D.pdb.gz	Antibacterial Nucleoside-Analog Inhibitor of Bacterial RNA Polymerase.
19	PDB:7d5sB2	0.077	0.064	2.953	851	0.030	0.024	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:1k9yA	0.052	0.085	3.526	354	0.015	0.028	1k9yA.pdb.gz	Structural enzymology of Li(+)-sensitive/Mg(2+)-dependent phosphatases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KMN0	0.0	1304	651	0.935	0.966	A3KMN0_MOUSE Zbtb16 protein (Fragment) OS=Mus musculus OX=10090 GN=Zbtb16 PE=2 SV=1
2	E7FGS1	0.0	951	659	0.719	0.734	E7FGS1_DANRE Zinc finger and BTB domain-containing 16b OS=Danio rerio OX=7955 GN=zbtb16b PE=1 SV=1
3	F7IXA3	0.0	649	357	0.492	0.927	F7IXA3_RAT Zinc finger and BTB domain containing 16 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=2 SV=1
4	Q05516	0.0	1398	673	1.000	1.000	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
5	Q3UQ17	0.0	1350	673	0.967	0.967	Q3UQ17_MOUSE Zinc finger and BTB domain containing 16 OS=Mus musculus OX=10090 GN=Zbtb16 PE=1 SV=1
6	Q5S3S9	0.0	1322	673	0.961	0.961	Q5S3S9_RAT Promyelocytic leukemia zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=1 SV=1
7	Q802Y8	0.0	1066	671	0.795	0.797	ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio OX=7955 GN=zbtb16a PE=1 SV=1
8	M5AK03	2.64e-168	482	235	0.342	0.979	M5AK03_RAT Zinc finger and BTB domain containing 16 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=2 SV=1
9	Q6PK81	3.56e-59	207	442	0.158	0.240	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
10	Q96HQ0	3.99e-59	209	510	0.156	0.206	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
11	Q8NF99	5.72e-59	209	534	0.156	0.197	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
12	P51523	7.92e-59	213	738	0.160	0.146	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
13	Q9C0F3	1.48e-56	201	470	0.162	0.232	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
14	Q6ZN57	3.24e-56	200	461	0.165	0.241	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
15	Q6AZW8	4.71e-55	193	331	0.159	0.323	ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens OX=9606 GN=ZNF660 PE=1 SV=1
16	Q15776	5.47e-55	199	578	0.159	0.185	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
17	Q8TC21	7.95e-55	197	504	0.158	0.210	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
18	P35789	9.98e-55	199	620	0.158	0.171	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	Q86UD4	1.21e-54	197	541	0.158	0.196	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
20	Q8N9F8	1.69e-54	197	522	0.149	0.192	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.8e-22	91.0	BTB/POZ domain
2	PF12773 DZR	39	15.6	Double zinc ribbon
3	PF02945 Endonuclease_7	68	14.8	Recombination endonuclease VII
4	PF00096 zf-C2H2	2.5e-24	95.5	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	7.5e+02	11.3	zinc-finger C2H2-type
6	PF12756 zf-C2H2_2	6.4	18.5	C2H2 type zinc-finger (2 copies)
7	PF13894 zf-C2H2_4	3.3e-25	97.6	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	1.9e-10	51.7	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	7.3e-09	46.9	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	2.5e-32	121.1	Zinc-finger double domain
11	PF12874 zf-met	1e-10	52.8	Zinc-finger of C2H2 type
12	PF18439 zf_UBZ	0.28	22.2	Ubiquitin-Binding Zinc Finger
13	PF17032 zinc_ribbon_15	1.2e+02	14.9	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.990	Nuclear receptor corepressor 1
2	9606.ENSP00000362649	0.990	Histone deacetylase 1
3	9606.ENSP00000384018	0.989	Nuclear receptor corepressor 2
4	9606.ENSP00000264414	0.988	Cullin-3
5	9606.ENSP00000254066	0.977	Retinoic acid receptor alpha
6	9606.ENSP00000338235	0.971	Protein LYRIC
7	9606.ENSP00000264606	0.930	Histone deacetylase 4
8	9606.ENSP00000378402	0.895	Paired amphipathic helix protein Sin3a
9	9606.ENSP00000304783	0.876	Prestin
10	9606.ENSP00000402257	0.859	Protein CBFA2T1
11	9606.ENSP00000230990	0.839	Proheparin-binding EGF-like growth factor
12	9606.ENSP00000386665	0.839	Four and a half LIM domains protein 2
13	9606.ENSP00000347591	0.807	GDNF family receptor alpha-1
14	9606.ENSP00000360973	0.805	Type-2 angiotensin II receptor
15	9606.ENSP00000339063	0.777	Elongation factor 1-alpha 1
16	9606.ENSP00000320147	0.771	Histone-lysine N-methyltransferase EZH2
17	9606.ENSP00000363822	0.770	Androgen receptor
18	9606.ENSP00000406209	0.767	Epsin-1
19	9606.ENSP00000275764	0.736	Stimulated by retinoic acid gene 8 protein homolog
20	9606.ENSP00000447173	0.722	Vitamin D3 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.989	DNA-binding transcription factor activity
GO:0003690	0.989	double-stranded DNA binding
GO:1990837	0.981	sequence-specific double-stranded DNA binding
GO:0000981	0.979	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.973	transcription cis-regulatory region binding
GO:0001227	0.947	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.844	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.816	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001222	0.757	transcription corepressor binding
GO:0042802	0.516	identical protein binding
GO:0046983	0.428	protein dimerization activity
GO:0042803	0.422	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0009889	0.960	regulation of biosynthetic process
GO:0032502	0.930	developmental process
GO:0010556	0.927	regulation of macromolecule biosynthetic process
GO:0031326	0.926	regulation of cellular biosynthetic process
GO:0051252	0.925	regulation of RNA metabolic process
GO:0032501	0.918	multicellular organismal process
GO:0010468	0.915	regulation of gene expression
GO:2001141	0.912	regulation of RNA biosynthetic process
GO:0048856	0.886	anatomical structure development
GO:1903506	0.875	regulation of nucleic acid-templated transcription
GO:0048522	0.870	positive regulation of cellular process
GO:0048519	0.856	negative regulation of biological process
GO:0048523	0.844	negative regulation of cellular process
GO:0006355	0.830	regulation of DNA-templated transcription
GO:0009893	0.828	positive regulation of metabolic process
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0007275	0.751	multicellular organism development
GO:0030326	0.682	embryonic limb morphogenesis
GO:0035137	0.669	hindlimb morphogenesis
GO:0051173	0.491	positive regulation of nitrogen compound metabolic process
GO:0031325	0.491	positive regulation of cellular metabolic process
GO:0006357	0.487	regulation of transcription by RNA polymerase II
GO:0051172	0.479	negative regulation of nitrogen compound metabolic process
GO:0010605	0.474	negative regulation of macromolecule metabolic process
GO:0031324	0.470	negative regulation of cellular metabolic process
GO:0045935	0.468	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.466	positive regulation of biosynthetic process
GO:0051239	0.462	regulation of multicellular organismal process
GO:0031328	0.457	positive regulation of cellular biosynthetic process
GO:0050896	0.446	response to stimulus
GO:0045934	0.440	negative regulation of nucleobase-containing compound metabolic process
GO:0010557	0.432	positive regulation of macromolecule biosynthetic process
GO:0051253	0.432	negative regulation of RNA metabolic process
GO:0009890	0.429	negative regulation of biosynthetic process
GO:0010558	0.416	negative regulation of macromolecule biosynthetic process
GO:0031327	0.415	negative regulation of cellular biosynthetic process
GO:0000122	0.397	negative regulation of transcription by RNA polymerase II
GO:1903508	0.396	positive regulation of nucleic acid-templated transcription
GO:0045893	0.380	positive regulation of DNA-templated transcription
GO:0048731	0.344	system development
GO:0050793	0.327	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.855	organelle lumen
GO:0031981	0.854	nuclear lumen
GO:0005737	0.723	cytoplasm
GO:0005654	0.631	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]