StarFunc result for job id Q05586

User Input

>input (938 residues)
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pe5C	0.715	0.874	0.000	754	0.790	0.983	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
2	PDB:4tllA	0.733	0.884	0.000	767	0.736	0.900	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
3	PDB:4tlmC	0.710	0.873	0.000	750	0.721	0.901	4tlmC.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
4	PDB:5iouA	0.796	0.923	0.000	803	0.776	0.907	5iouA.pdb.gz	Mechanism of NMDA Receptor Inhibition and Activation.
5	AFDB:P35438	0.932	0.932	0.000	938	0.990	0.990	P35438.pdb.gz	NMDZ1_MOUSE Glutamate receptor ionotropic, NMDA 1 OS=Mus musculus OX=10090 GN=Grin1 PE=1 SV=1
6	AFDB:Q24418	0.784	0.741	0.000	997	0.456	0.429	Q24418.pdb.gz	NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Nmdar1 PE=1 SV=1
7	PDB:5ipqA	0.453	0.611	1.009E-101	658	0.626	0.892	5ipqA.pdb.gz
8	PDB:5ipqC	0.588	0.853	1.097E-94	627	0.594	0.888	5ipqC.pdb.gz
9	AFDB:G5EGQ9	0.685	0.634	3.244E-79	1025	0.310	0.284	G5EGQ9.pdb.gz	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
10	AFDB:P35436	0.337	0.222	2.083E-65	1464	0.256	0.164	P35436.pdb.gz	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
11	AFDB:A7XY94	0.344	0.230	2.826E-64	1448	0.252	0.163	A7XY94.pdb.gz	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
12	AFDB:Q14957	0.328	0.258	1.452E-62	1233	0.239	0.182	Q14957.pdb.gz	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
13	AFDB:O60391	0.664	0.605	2.529E-62	1043	0.257	0.231	O60391.pdb.gz	NMD3B_HUMAN Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2
14	AFDB:Q9W581	0.568	0.507	4.167E-62	1083	0.249	0.216	Q9W581.pdb.gz	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
15	AFDB:A2AIR5	0.511	0.442	1.196E-61	1135	0.236	0.195	A2AIR5.pdb.gz	NMD3A_MOUSE Glutamate receptor ionotropic, NMDA 3A OS=Mus musculus OX=10090 GN=Grin3a PE=1 SV=1
16	AFDB:Q01098	0.329	0.255	1.578E-61	1239	0.232	0.176	Q01098.pdb.gz	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
17	PDB:7rz4A	0.437	0.417	1.011E-51	993	0.211	0.199	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
18	PDB:7rzaA	0.399	0.385	1.228E-50	981	0.215	0.206	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
19	PDB:7ocaA	0.383	0.447	1.195E-49	775	0.211	0.255	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
20	PDB:5weoA	0.429	0.410	1.915E-48	988	0.212	0.201	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L8F5J9	0.0	1746	903	0.884	0.918	NMDZ1_XENLA Glutamate receptor ionotropic, NMDA 1 OS=Xenopus laevis OX=8355 GN=grin1 PE=1 SV=1
2	P35438	0.0	1950	938	0.990	0.990	NMDZ1_MOUSE Glutamate receptor ionotropic, NMDA 1 OS=Mus musculus OX=10090 GN=Grin1 PE=1 SV=1
3	P35439	0.0	1952	938	0.993	0.993	NMDZ1_RAT Glutamate receptor ionotropic, NMDA 1 OS=Rattus norvegicus OX=10116 GN=Grin1 PE=1 SV=1
4	Q05586	0.0	1962	938	1.000	1.000	NMDZ1_HUMAN Glutamate receptor ionotropic, NMDA 1 OS=Homo sapiens OX=9606 GN=GRIN1 PE=1 SV=1
5	Q24418	0.0	801	997	0.447	0.420	NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Nmdar1 PE=1 SV=1
6	Q62683	0.0	1948	938	0.991	0.991	Q62683_RAT Glutamate receptor OS=Rattus norvegicus OX=10116 PE=2 SV=1
7	G5EGQ9	2.95e-146	462	1025	0.306	0.280	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
8	Q00960	8.91e-90	315	1482	0.260	0.165	NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus OX=10116 GN=Grin2b PE=1 SV=1
9	Q13224	1.04e-89	315	1484	0.261	0.165	NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens OX=9606 GN=GRIN2B PE=1 SV=3
10	Q6IWN7	2.03e-89	310	1070	0.246	0.216	Q6IWN7_DROME NMDA receptor 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
11	A7XY94	2.42e-89	314	1448	0.233	0.151	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
12	X2JDW0	2.91e-89	309	1082	0.246	0.213	X2JDW0_DROME NMDA receptor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
13	Q9W581	3.60e-89	309	1083	0.246	0.213	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
14	Q01097	1.29e-88	312	1482	0.259	0.164	NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3
15	E1JJC6	4.07e-88	304	941	0.228	0.227	E1JJC6_DROME NMDA receptor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
16	Q8MM14	4.82e-87	300	902	0.221	0.229	Q8MM14_DROME Glutamate NMDA receptor subunit variant NR2-a OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
17	P35436	5.48e-86	304	1464	0.232	0.149	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
18	Q12879	6.32e-85	301	1464	0.229	0.147	NMDE1_HUMAN Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1
19	Q00959	6.38e-85	301	1464	0.229	0.147	NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2
20	B7ZSK1	4.88e-84	298	1451	0.226	0.146	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	8.2e-34	128.9	Receptor family ligand binding region
2	PF10562 CaM_bdg_C0	2.7e-10	51.4	Calmodulin-binding domain C0 of NMDA receptor NR1 subunit
3	PF20485 DUF6724	1.8e+02	13.4	Family of unknown function (DUF6724)
4	PF07885 Ion_trans_2	25	16.2	Ion channel
5	PF00060 Lig_chan	4.5e-35	132.1	Ligand-gated ion channel
6	PF10613 Lig_chan-Glu_bd	3.6e-29	112.6	Ligated ion channel L-glutamate- and glycine-binding site
7	PF13458 Peripla_BP_6	3.8	18.8	Periplasmic binding protein
8	PF00497 SBP_bac_3	8.7e-16	69.6	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000023869

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000030932	0.999	Discs, large homolog 4 (Drosophila)
2	9483.ENSCJAP00000040244	0.999	Glutamate receptor, ionotropic, N-methyl D-aspartate 2B
3	9483.ENSCJAP00000031583	0.994	Glutamate receptor, ionotropic, N-methyl D-aspartate 2A
4	9483.ENSCJAP00000031588	0.985	Uncharacterized protein
5	9483.ENSCJAP00000027194	0.981	Glutamate receptor, ionotropic, N-methyl D-aspartate 2C
6	9483.ENSCJAP00000028604	0.952	Discs, large homolog 3 (Drosophila)
7	9483.ENSCJAP00000039172	0.949	Calcium/calmodulin-dependent protein kinase II alpha
8	9483.ENSCJAP00000049930	0.936	Discs, large homolog 2 (Drosophila)
9	9483.ENSCJAP00000040112	0.932	annotation not available
10	9483.ENSCJAP00000025477	0.929	Discs, large homolog 1 (Drosophila)
11	9483.ENSCJAP00000000799	0.912	Glutamate receptor, ionotropic, N-methyl D-aspartate 2D
12	9483.ENSCJAP00000001194	0.912	Glutamate receptor, metabotropic 5
13	9483.ENSCJAP00000040396	0.909	Synaptic Ras GTPase activating protein 1
14	9483.ENSCJAP00000032742	0.904	Calmodulin 2 (phosphorylase kinase, delta)
15	9483.ENSCJAP00000040054	0.899	Tyrosine-protein kinase
16	9483.ENSCJAP00000016537	0.892	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
17	9483.ENSCJAP00000030334	0.878	Glutamate receptor, ionotropic, N-methyl-D-aspartate 3A
18	9483.ENSCJAP00000009029	0.875	FYN proto-oncogene, Src family tyrosine kinase
19	9483.ENSCJAP00000016803	0.869	Belongs to the PPP phosphatase family.
20	9483.ENSCJAP00000017309	0.859	Nitric oxide synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004972	1.000	NMDA glutamate receptor activity
GO:0005261	0.998	monoatomic cation channel activity
GO:0016594	0.989	glycine binding
GO:0046873	0.962	metal ion transmembrane transporter activity
GO:1901702	0.959	salt transmembrane transporter activity
GO:0098960	0.906	postsynaptic neurotransmitter receptor activity
GO:0099529	0.903	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.860	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0065007	0.995	biological regulation
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0007610	0.989	behavior
GO:0050877	0.989	nervous system process
GO:0007154	0.985	cell communication
GO:0051179	0.978	localization
GO:0051716	0.976	cellular response to stimulus
GO:0007215	0.968	glutamate receptor signaling pathway
GO:0051234	0.958	establishment of localization
GO:0065008	0.944	regulation of biological quality
GO:0042391	0.934	regulation of membrane potential
GO:0006810	0.933	transport
GO:0050890	0.925	cognition
GO:0010033	0.896	response to organic substance
GO:1901698	0.878	response to nitrogen compound
GO:0010243	0.824	response to organonitrogen compound
GO:0006811	0.740	monoatomic ion transport
GO:0055085	0.706	transmembrane transport
GO:0030001	0.696	metal ion transport
GO:1901700	0.637	response to oxygen-containing compound
GO:0010646	0.603	regulation of cell communication
GO:0023051	0.600	regulation of signaling
GO:0071702	0.598	organic substance transport
GO:0032502	0.584	developmental process
GO:0007611	0.570	learning or memory
GO:0099177	0.566	regulation of trans-synaptic signaling
GO:0050804	0.541	modulation of chemical synaptic transmission
GO:0048856	0.524	anatomical structure development
GO:0048518	0.496	positive regulation of biological process
GO:0048522	0.455	positive regulation of cellular process
GO:0007275	0.446	multicellular organism development
GO:0051239	0.423	regulation of multicellular organismal process
GO:0099537	0.410	trans-synaptic signaling
GO:0010035	0.399	response to inorganic substance
GO:0071840	0.392	cellular component organization or biogenesis
GO:0051641	0.380	cellular localization
GO:0048583	0.379	regulation of response to stimulus
GO:0032879	0.379	regulation of localization
GO:0048519	0.374	negative regulation of biological process
GO:0016043	0.350	cellular component organization
GO:0048731	0.344	system development
GO:0007268	0.327	chemical synaptic transmission
GO:0051049	0.326	regulation of transport
GO:0019222	0.306	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.998	synapse
GO:0008328	0.997	ionotropic glutamate receptor complex
GO:0043226	0.996	organelle
GO:0005737	0.996	cytoplasm
GO:0043229	0.990	intracellular organelle
GO:0012505	0.978	endomembrane system
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0097060	0.970	synaptic membrane
GO:0098794	0.961	postsynapse
GO:0017146	0.958	NMDA selective glutamate receptor complex
GO:0120025	0.842	plasma membrane bounded cell projection
GO:0098978	0.839	glutamatergic synapse
GO:0043005	0.829	neuron projection
GO:0031090	0.787	organelle membrane
GO:0036477	0.694	somatodendritic compartment
GO:0098793	0.673	presynapse
GO:0045211	0.646	postsynaptic membrane
GO:0098984	0.637	neuron to neuron synapse
GO:0099572	0.637	postsynaptic specialization
GO:0005783	0.637	endoplasmic reticulum
GO:0030425	0.623	dendrite
GO:0032279	0.611	asymmetric synapse
GO:0014069	0.579	postsynaptic density
GO:0030424	0.575	axon
GO:0099634	0.465	postsynaptic specialization membrane
GO:0031984	0.421	organelle subcompartment
GO:0060076	0.413	excitatory synapse
GO:0042734	0.399	presynaptic membrane
GO:0032589	0.394	neuron projection membrane
GO:0098688	0.385	parallel fiber to Purkinje cell synapse
GO:0098827	0.383	endoplasmic reticulum subcompartment
GO:0044309	0.381	neuron spine
GO:0042175	0.378	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0032590	0.373	dendrite membrane
GO:0098839	0.373	postsynaptic density membrane
GO:0043197	0.369	dendritic spine
GO:0005789	0.359	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]