StarFunc result for job id Q05655

User Input

>input (676 residues)
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R328	0.527	0.527	0.000	676	1.000	1.000	A0A024R328.pdb.gz
2	AFDB:P09215	0.793	0.796	0.000	673	0.895	0.899	P09215.pdb.gz	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
3	AFDB:Q7ZUC5	0.799	0.790	0.000	684	0.771	0.762	Q7ZUC5.pdb.gz	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1
4	AFDB:Q02111	0.694	0.665	6.424E-97	707	0.643	0.615	Q02111.pdb.gz	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
5	AFDB:F1R506	0.776	0.738	3.182E-95	713	0.648	0.614	F1R506.pdb.gz	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
6	AFDB:P34722	0.713	0.685	6.420E-81	704	0.487	0.467	P34722.pdb.gz	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2
7	AFDB:P13678	0.506	0.466	6.253E-71	739	0.439	0.402	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
8	AFDB:L7RTI5	0.485	0.446	7.700E-71	737	0.426	0.391	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
9	AFDB:B8A467	0.501	0.461	4.288E-70	738	0.428	0.392	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
10	AFDB:H9G2Y7	0.479	0.426	3.097E-69	763	0.451	0.400	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
11	PDB:3pfqA	0.461	0.592	1.825E-36	523	0.343	0.444	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.429	0.708	1.070E-27	405	0.180	0.301	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:3nynA	0.427	0.516	1.172E-26	554	0.173	0.211	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
14	PDB:6pjxA	0.428	0.529	6.528E-26	543	0.175	0.217	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:5x3fB	0.393	0.737	8.468E-26	349	0.178	0.344	5x3fB.pdb.gz
16	PDB:3c4wB	0.392	0.508	8.921E-26	519	0.175	0.227	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4yhjA	0.429	0.570	1.755E-25	501	0.182	0.246	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
18	PDB:6s9wA	0.373	0.599	3.276E-25	411	0.206	0.338	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:4mk0A	0.422	0.451	3.451E-25	631	0.151	0.162	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:3pvuA	0.389	0.430	4.034E-25	609	0.145	0.161	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A494C1T7	625	295	0.436	1.000	A0A494C1T7_HUMAN Protein kinase C delta (Fragment) OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=1
2	B8A467	570	738	0.438	0.401	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
3	F1R506	922	713	0.648	0.614	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
4	H9G2Y7	595	763	0.445	0.394	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
5	L7RTI5	577	737	0.432	0.396	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
6	P09215	1286	673	0.895	0.899	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
7	P09216	577	737	0.433	0.398	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
8	P13678	576	739	0.448	0.410	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
9	P16054	578	737	0.436	0.400	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
10	P23298	555	683	0.420	0.416	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
11	P24723	553	683	0.419	0.414	KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens OX=9606 GN=PRKCH PE=1 SV=4
12	P28867	1292	674	0.904	0.907	KPCD_MOUSE Protein kinase C delta type OS=Mus musculus OX=10090 GN=Prkcd PE=1 SV=3
13	P34722	661	704	0.484	0.464	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2
14	P34885	595	707	0.445	0.426	KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=2
15	P83099	602	671	0.442	0.446	KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster OX=7227 GN=Pkcdelta PE=2 SV=3
16	Q02111	918	707	0.648	0.620	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
17	Q02156	577	737	0.432	0.396	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
18	Q04759	915	706	0.652	0.625	KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens OX=9606 GN=PRKCQ PE=1 SV=3
19	Q05655	1415	676	1.000	1.000	KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2
20	Q64617	553	683	0.419	0.414	KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus OX=10116 GN=Prkch PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	19	15.8	ABC1 atypical kinase-like domain
2	PF01636 APH	5e+02	11.9	Phosphotransferase enzyme family
3	PF00130 C1_1	8.3e-29	110.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	2.3	19.9	C1 domain
5	PF12773 DZR	2.4e+02	13.1	Double zinc ribbon
6	PF14531 Kinase-like	9	17.1	Kinase-like
7	PF00628 PHD	1.1e+02	14.1	PHD-finger
8	PF00069 Pkinase	6.5e-58	207.7	Protein kinase domain
9	PF00433 Pkinase_C	1e-05	37.4	Protein kinase C terminal domain
10	PF17667 Pkinase_fungal	2.2e+02	12.0	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	1.8e-35	134.1	Protein tyrosine and serine/threonine kinase
12	PF08746 zf-RING-like	1.1	20.9	RING-like domain
13	PF16744 zf-RING_15	9.1	17.8	KIAA1045 RING finger
14	PF13901 zf-RING_9	27	16.2	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354394	0.996	Signal transducer and activator of transcription 1-alpha/beta
2	9606.ENSP00000304895	0.989	Insulin receptor substrate 1
3	9606.ENSP00000385269	0.989	ELAV-like protein 1
4	9606.ENSP00000289473	0.988	Neutrophil cytosol factor 1
5	9606.ENSP00000426909	0.988	Receptor of activated protein C kinase 1
6	9606.ENSP00000269305	0.987	Cellular tumor antigen p53
7	9606.ENSP00000346671	0.986	Tyrosine-protein kinase Fyn
8	9606.ENSP00000264657	0.984	Signal transducer and activator of transcription 3
9	9606.ENSP00000311032	0.984	Caspase-3
10	9606.ENSP00000401303	0.977	SHC-transforming protein 1
11	9606.ENSP00000296129	0.976	CUB domain-containing protein 1
12	9606.ENSP00000338345	0.971	Alpha-synuclein
13	9606.ENSP00000362680	0.971	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000344220	0.966	3-phosphoinositide-dependent protein kinase 1
15	9606.ENSP00000282561	0.962	Gap junction alpha-1 protein
16	9606.ENSP00000302665	0.960	Insulin-like growth factor I
17	9606.ENSP00000380638	0.954	Protein-tyrosine kinase 2-beta
18	9606.ENSP00000428924	0.954	Tyrosine-protein kinase Lyn
19	9606.ENSP00000263025	0.953	Mitogen-activated protein kinase 3
20	9606.ENSP00000356505	0.951	Neutrophil cytosol factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004697	1.000	protein kinase C activity
GO:0019899	0.962	enzyme binding
GO:0019901	0.942	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0008152	0.990	metabolic process
GO:0023052	0.984	signaling
GO:0007154	0.981	cell communication
GO:0019222	0.979	regulation of metabolic process
GO:0071704	0.978	organic substance metabolic process
GO:0048583	0.978	regulation of response to stimulus
GO:0044238	0.970	primary metabolic process
GO:0016310	0.968	phosphorylation
GO:0048518	0.960	positive regulation of biological process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0048522	0.948	positive regulation of cellular process
GO:0080090	0.941	regulation of primary metabolic process
GO:0051716	0.934	cellular response to stimulus
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0019538	0.929	protein metabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0006468	0.922	protein phosphorylation
GO:0048523	0.908	negative regulation of cellular process
GO:0023051	0.883	regulation of signaling
GO:0010646	0.883	regulation of cell communication
GO:0007165	0.880	signal transduction
GO:0048584	0.827	positive regulation of response to stimulus
GO:0065009	0.797	regulation of molecular function
GO:0051128	0.771	regulation of cellular component organization
GO:0009893	0.766	positive regulation of metabolic process
GO:0032501	0.763	multicellular organismal process
GO:0010604	0.755	positive regulation of macromolecule metabolic process
GO:0044093	0.675	positive regulation of molecular function
GO:0009966	0.675	regulation of signal transduction
GO:0010468	0.674	regulation of gene expression
GO:0019219	0.673	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.669	regulation of protein metabolic process
GO:0031326	0.666	regulation of cellular biosynthetic process
GO:0051239	0.661	regulation of multicellular organismal process
GO:0010556	0.659	regulation of macromolecule biosynthetic process
GO:0035556	0.635	intracellular signal transduction
GO:0006355	0.615	regulation of DNA-templated transcription
GO:0006950	0.603	response to stress
GO:0002376	0.569	immune system process
GO:0051173	0.545	positive regulation of nitrogen compound metabolic process
GO:0031325	0.543	positive regulation of cellular metabolic process
GO:0044087	0.527	regulation of cellular component biogenesis
GO:0007166	0.516	cell surface receptor signaling pathway
GO:0070887	0.511	cellular response to chemical stimulus
GO:0050790	0.510	regulation of catalytic activity
GO:0031399	0.498	regulation of protein modification process
GO:0051174	0.495	regulation of phosphorus metabolic process
GO:0043067	0.486	regulation of programmed cell death
GO:0002682	0.484	regulation of immune system process
GO:0010033	0.474	response to organic substance
GO:0042981	0.469	regulation of apoptotic process
GO:0023056	0.465	positive regulation of signaling
GO:0010647	0.461	positive regulation of cell communication
GO:0009605	0.440	response to external stimulus
GO:1902531	0.440	regulation of intracellular signal transduction
GO:0065008	0.437	regulation of biological quality
GO:0042127	0.423	regulation of cell population proliferation
GO:0009892	0.423	negative regulation of metabolic process
GO:0051247	0.413	positive regulation of protein metabolic process
GO:0019220	0.403	regulation of phosphate metabolic process
GO:0071840	0.390	cellular component organization or biogenesis
GO:0048585	0.388	negative regulation of response to stimulus
GO:0080134	0.367	regulation of response to stress
GO:0043085	0.361	positive regulation of catalytic activity
GO:0032879	0.348	regulation of localization
GO:0016043	0.344	cellular component organization
GO:0042325	0.344	regulation of phosphorylation
GO:0009967	0.335	positive regulation of signal transduction
GO:0030155	0.327	regulation of cell adhesion
GO:0050865	0.327	regulation of cell activation
GO:0048856	0.325	anatomical structure development
GO:0071310	0.324	cellular response to organic substance
GO:1900076	0.319	regulation of cellular response to insulin stimulus
GO:0046626	0.319	regulation of insulin receptor signaling pathway
GO:0009968	0.314	negative regulation of signal transduction
GO:0001932	0.311	regulation of protein phosphorylation
GO:1900077	0.306	negative regulation of cellular response to insulin stimulus
GO:0046627	0.303	negative regulation of insulin receptor signaling pathway
GO:0010605	0.302	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.984	membrane
GO:0071944	0.972	cell periphery
GO:0005886	0.964	plasma membrane
GO:0043226	0.956	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0043229	0.918	intracellular organelle
GO:0043231	0.772	intracellular membrane-bounded organelle
GO:0070013	0.329	intracellular organelle lumen
GO:0005634	0.300	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.13	1.000	protein kinase C.

[back to server]