StarFunc result for job id Q05707

User Input

>input (1796 residues)
MKIFQRKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRHF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTLCSRVEEQDREIKASAHAITGPPTELI
TSEVTARSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGTVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASDLLLYDVTENSMRVKWDAVPGASGYLILYAPLT
EGLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNVGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
IAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLKEEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIVPTTSVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYMTAQGDPEEEV
IGTVMVPGSQNNLLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSGPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAKHVEMTSLCAHWQVHRHATAYRVVIESLQDRQK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSLPTRPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVV
ITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPVVHKDGIDLAGFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFP
CYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVI
LDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGE
KAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRD
DESCPDLPHSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEIGLPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDG
SSGPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRSVA
RQVCEQLIQSHMARYTAILNQIPSHSSSIRTVQGPPGEPGRPGSPGAPGEQGPPGTPGFP
GNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGP
PGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPDQPEFTPVQDELEAMELWGPGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R9Y1	0.287	0.278	0.000	1864	0.620	0.598	F1R9Y1.pdb.gz	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
2	AFDB:Q05707	0.998	0.998	0.000	1796	1.000	1.000	Q05707.pdb.gz	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
3	AFDB:Q80X19	0.495	0.495	0.000	1797	0.898	0.897	Q80X19.pdb.gz	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
4	AFDB:A2CF37	0.120	0.147	3.587E-52	1350	0.097	0.129	A2CF37.pdb.gz
5	AFDB:A0A2R8QRK0	0.114	0.133	4.345E-24	1420	0.058	0.074	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
6	AFDB:F1QBD4	0.121	0.142	1.037E-21	1387	0.114	0.147	F1QBD4.pdb.gz
7	AFDB:A0A0G2JZA1	0.116	0.127	1.874E-21	1512	0.109	0.129	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
8	PDB:7q5zA	0.101	0.123	1.806E-15	1344	0.051	0.068	7q5zA.pdb.gz
9	PDB:5oj2B	0.091	0.179	4.388E-15	692	0.046	0.118	5oj2B.pdb.gz
10	PDB:6h03A	0.101	0.135	1.434E-14	1223	0.044	0.065	6h03A.pdb.gz
11	PDB:1e07A	0.107	0.227	9.814E-14	642	0.040	0.112	1e07A.pdb.gz
12	PDB:5a42A	0.088	0.095	2.161E-13	1597	0.066	0.075	5a42A.pdb.gz
13	PDB:7q1yA	0.097	0.117	4.310E-13	1374	0.052	0.068	7q1yA.pdb.gz
14	PDB:4nehA	0.089	0.143	1.156E-12	1084	0.075	0.124	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
15	PDB:4nenA	0.091	0.149	2.089E-12	1063	0.075	0.127	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:8eyyA	0.088	0.172	2.422E-12	775	0.026	0.059	8eyyA.pdb.gz
17	PDB:4ziqA	0.065	0.075	1.658E-11	1450	0.039	0.048	4ziqA.pdb.gz
18	AFDB:E9Q8E3	0.050	0.093	2.849E-10	909	0.065	0.129	E9Q8E3.pdb.gz	E9Q8E3_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
19	AFDB:Q9UKK3	0.091	0.094	4.666E-10	1724	0.086	0.090	Q9UKK3.pdb.gz	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
20	AFDB:Q8TEP8	0.064	0.050	8.567E-9	2537	0.060	0.042	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R9Y1	0.0	2002	1864	0.616	0.594	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
2	F1S285	0.0	3040	1760	0.899	0.917	F1S285_PIG Collagen type XIV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL14A1 PE=1 SV=3
3	Q05707	0.0	3665	1796	1.000	1.000	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
4	Q60847	0.0	972	3120	0.364	0.209	COCA1_MOUSE Collagen alpha-1(XII) chain OS=Mus musculus OX=10090 GN=Col12a1 PE=2 SV=3
5	Q80X19	0.0	3031	1797	0.898	0.898	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
6	Q99715	0.0	962	3063	0.362	0.212	COCA1_HUMAN Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1 PE=1 SV=2
7	Q9P218	2.30e-133	452	1284	0.163	0.228	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
8	F1SKM1	2.33e-93	340	2938	0.152	0.093	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
9	A0A158RFW1	7.20e-91	321	957	0.143	0.269	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
10	Q96P44	7.20e-91	321	957	0.143	0.269	COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1
11	Q02388	2.55e-90	330	2944	0.153	0.093	CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
12	F5GZK2	6.74e-87	309	956	0.138	0.258	F5GZK2_HUMAN Collagen type XXI alpha 1 chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=1 SV=2
13	Q63870	7.28e-82	303	2944	0.146	0.089	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
14	M5BFV8	2.02e-79	293	1622	0.153	0.169	M5BFV8_DANRE Collagen alpha-1(XXII) chain precursor OS=Danio rerio OX=7955 GN=prp PE=1 SV=1
15	Q8NFW1	2.16e-70	264	1626	0.130	0.144	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
16	E9Q7P1	3.76e-69	260	1613	0.115	0.128	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
17	A2CEW3	9.73e-50	197	2500	0.107	0.077	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
18	P11722	5.52e-49	195	2483	0.100	0.072	FINC_CHICK Fibronectin OS=Gallus gallus OX=9031 GN=FN1 PE=2 SV=4
19	A8TX70	1.85e-48	194	2615	0.124	0.085	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
20	P07589	5.94e-47	189	2478	0.097	0.070	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17425 Arylsulfotran_N	0.071	24.5	Arylsulfotransferase Ig-like domain
2	PF02018 CBM_4_9	5.1	18.8	Carbohydrate binding domain
3	PF01391 Collagen	1.5e-31	119.3	Collagen triple helix repeat (20 copies)
4	PF16258 DUF4912	1.3e+02	14.2	Domain of unknown function (DUF4912)
5	PF16323 DUF4959	31	16.3	Domain of unknown function (DUF4959)
6	PF00041 fn3	3.3e-95	323.9	Fibronectin type III domain
7	PF16893 fn3_2	3.3	19.3	Fibronectin type III domain
8	PF09294 Interfer-bind	2.6e-05	35.8	Interferon-alpha/beta receptor, fibronectin type III
9	PF10179 NDNF	0.00012	33.6	Neuron-derived neurotrophic factor, first Fn(III) domain
10	PF16656 Pur_ac_phosph_N	1.5e-10	52.9	Purple acid Phosphatase, N-terminal domain
11	PF00092 VWA	3.5e-103	354.8	von Willebrand factor type A domain
12	PF13519 VWA_2	7.1e-27	105.6	von Willebrand factor type A domain
13	PF13768 VWA_3	0.0057	28.1	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297848

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361405	0.934	Matrix metalloproteinase-9
2	9606.ENSP00000260302	0.924	Collagenase 3
3	9606.ENSP00000401749	0.916	Prolyl 4-hydroxylase subunit alpha-3
4	9606.ENSP00000263556	0.906	Prolyl 4-hydroxylase subunit alpha-1
5	9606.ENSP00000384999	0.905	Prolyl 4-hydroxylase subunit alpha-2
6	9606.ENSP00000362776	0.814	Collagen alpha-1(XVI) chain
7	9606.ENSP00000332371	0.803	Collagen alpha-1(VII) chain
8	9606.ENSP00000300527	0.798	Collagen alpha-2(VI) chain
9	9606.ENSP00000361834	0.765	Collagen alpha-2(IX) chain
10	9606.ENSP00000325146	0.764	Collagen alpha-1(XII) chain
11	9606.ENSP00000349790	0.764	Collagen alpha-1(IX) chain
12	9606.ENSP00000341640	0.756	Collagen alpha-3(IX) chain
13	9606.ENSP00000196061	0.729	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
14	9606.ENSP00000434412	0.707	Serpin H1
15	9606.ENSP00000359114	0.695	Collagen alpha-1(XI) chain
16	9606.ENSP00000282903	0.687	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
17	9606.ENSP00000236040	0.686	Prolyl 3-hydroxylase 1
18	9606.ENSP00000316881	0.667	Prolyl 3-hydroxylase 2
19	9606.ENSP00000262551	0.663	Mimecan
20	9606.ENSP00000360882	0.663	Collagen alpha-1(V) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	0.999	RNA binding
GO:0005515	0.995	protein binding
GO:0005198	0.772	structural molecule activity
GO:0005201	0.589	extracellular matrix structural constituent
GO:0044877	0.381	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048856	0.981	anatomical structure development
GO:0030198	0.895	extracellular matrix organization
GO:0032501	0.884	multicellular organismal process
GO:0050789	0.882	regulation of biological process
GO:0007275	0.835	multicellular organism development
GO:0050794	0.719	regulation of cellular process
GO:0048731	0.690	system development
GO:0009888	0.585	tissue development
GO:0048513	0.506	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005576	0.984	extracellular region
GO:0005615	0.938	extracellular space
GO:0005783	0.933	endoplasmic reticulum
GO:0070013	0.927	intracellular organelle lumen
GO:0005788	0.901	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]