StarFunc result for job id Q05823

User Input

>input (741 residues)
MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGW
TPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNE
CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGH
VEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGK
TPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGK
LKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCG
YTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFE
DLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVG
DLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTH
SPNKPQCDGAGGASGLASPGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05823	1.000	1.000	0.000	741	1.000	1.000	Q05823.pdb.gz	RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=2
2	PDB:4oauC	0.928	0.993	2.032E-96	692	0.931	0.997	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
3	AFDB:Q05921	0.884	0.891	2.354E-80	735	0.640	0.645	Q05921.pdb.gz	RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus OX=10090 GN=Rnasel PE=1 SV=2
4	AFDB:G3V915	0.543	0.545	4.513E-79	738	0.628	0.630	G3V915.pdb.gz	G3V915_RAT Ribonuclease L OS=Rattus norvegicus OX=10116 GN=Rnasel PE=4 SV=1
5	AFDB:Q59H18	0.326	0.296	3.493E-22	835	0.209	0.186	Q59H18.pdb.gz	TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens OX=9606 GN=TNNI3K PE=1 SV=3
6	AFDB:Q54HC6	0.270	0.145	1.282E-17	1460	0.170	0.086	Q54HC6.pdb.gz	ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum OX=44689 GN=arkA PE=1 SV=1
7	AFDB:Q9C5S2	0.405	0.360	8.299E-17	841	0.148	0.131	Q9C5S2.pdb.gz	IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana OX=3702 GN=IRE1A PE=1 SV=1
8	AFDB:F4KH40	0.411	0.348	2.066E-16	887	0.138	0.115	F4KH40.pdb.gz	F4KH40_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=IRE1-1 PE=1 SV=1
9	AFDB:Q7XIT1	0.408	0.343	3.795E-16	893	0.150	0.124	Q7XIT1.pdb.gz	IRE1_ORYSJ Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Oryza sativa subsp. japonica OX=39947 GN=IRE1 PE=1 SV=1
10	AFDB:A0A0G2K2H4	0.411	0.317	4.924E-16	977	0.135	0.102	A0A0G2K2H4.pdb.gz	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
11	AFDB:Q76MJ5	0.409	0.333	5.143E-16	926	0.123	0.098	Q76MJ5.pdb.gz	ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens OX=9606 GN=ERN2 PE=1 SV=4
12	PDB:8cs9A	0.352	0.329	4.019E-14	796	0.113	0.106	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:5vkqA	0.231	0.135	1.188E-10	1499	0.163	0.081	5vkqA.pdb.gz
14	PDB:4krcA	0.251	0.583	1.137E-9	297	0.061	0.152	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:6v9hC	0.278	0.694	1.295E-9	270	0.094	0.259	6v9hC.pdb.gz
16	PDB:4eomC	0.263	0.653	2.830E-9	276	0.066	0.178	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:1unlA	0.255	0.605	2.956E-9	292	0.069	0.175	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:2dvwA	0.260	0.761	3.835E-9	229	0.086	0.279	2dvwA.pdb.gz
19	PDB:4yc3A	0.258	0.600	1.136E-8	295	0.081	0.203	4yc3A.pdb.gz
20	PDB:4zhxA	0.243	0.416	2.377E-8	409	0.076	0.137	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V915	0.0	932	738	0.628	0.630	G3V915_RAT Ribonuclease L OS=Rattus norvegicus OX=10116 GN=Rnasel PE=4 SV=1
2	Q05823	0.0	1535	741	1.000	1.000	RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=2
3	Q05921	0.0	937	735	0.641	0.646	RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus OX=10090 GN=Rnasel PE=1 SV=2
4	Q1RLL8	0.0	1532	741	0.997	0.997	Q1RLL8_HUMAN Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=1
5	Q80WM6	0.0	932	738	0.628	0.630	Q80WM6_RAT 2',5'-oligoisoadenylate synthetase-dependent ribonuclease L OS=Rattus norvegicus OX=10116 GN=Rnasel PE=2 SV=1
6	E9Q9B7	1.22e-30	132	1793	0.139	0.057	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
7	A0A1Y7VME9	1.32e-30	132	1763	0.139	0.058	A0A1Y7VME9_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
8	B2RXL7	1.46e-30	132	1672	0.139	0.062	B2RXL7_MOUSE Kidins220 protein OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
9	A0A1Y7VMH7	1.60e-30	131	1672	0.139	0.062	A0A1Y7VMH7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
10	Q9EQG6	2.96e-30	130	1762	0.138	0.058	KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2
11	Q9ULH0	4.95e-30	130	1771	0.139	0.058	KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3
12	H0YM23	3.47e-27	121	2487	0.132	0.039	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
13	O75179	3.54e-27	121	2603	0.132	0.038	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
14	Q99NH0	4.03e-27	121	2603	0.132	0.038	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
15	A0A0R4IUB2	6.58e-27	120	2580	0.131	0.038	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
16	Q9ULJ7	6.70e-27	120	1429	0.143	0.074	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
17	E9QEX9	7.13e-27	120	2607	0.131	0.037	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
18	Q7T163	1.78e-26	119	1680	0.123	0.054	KDISB_DANRE Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3
19	A0A0G2K916	2.05e-26	119	2615	0.130	0.037	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
20	Q8IWZ3	4.55e-26	117	2542	0.130	0.038	ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5.1e-32	120.2	Ankyrin repeat
2	PF12796 Ank_2	3.7e-39	144.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.1e-31	114.4	Ankyrin repeat
4	PF13637 Ank_4	9.3e-33	123.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9.8e-32	119.9	Ankyrin repeats (many copies)
6	PF01633 Choline_kinase	3.1e+02	12.4	Choline/ethanolamine kinase
7	PF19902 DUF6375	2.9	20.0	Family of unknown function (DUF6375)
8	PF06293 Kdo	0.12	23.3	Lipopolysaccharide kinase (Kdo/WaaP) family
9	PF00069 Pkinase	6.4e-12	57.0	Protein kinase domain
10	PF17667 Pkinase_fungal	97	13.2	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	0.00026	31.9	Protein tyrosine and serine/threonine kinase
12	PF06479 Ribonuc_2-5A	2.7e-23	93.9	Ribonuclease 2-5A
13	PF01163 RIO1	29	15.7	RIO1 family
14	PF19974 TCAD9	1.8e+02	12.6	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388001	0.984	2'-5'-oligoadenylate synthase 1
2	9606.ENSP00000296577	0.981	ATP-binding cassette sub-family E member 1
3	9606.ENSP00000228928	0.978	2'-5'-oligoadenylate synthase 3
4	9606.ENSP00000257570	0.977	2'-5'-oligoadenylate synthase-like protein
5	9606.ENSP00000342278	0.971	2'-5'-oligoadenylate synthase 2
6	9606.ENSP00000368699	0.971	Ubiquitin-like protein ISG15
7	9606.ENSP00000381601	0.971	Interferon-induced GTP-binding protein Mx1
8	9606.ENSP00000371471	0.967	Radical S-adenosyl methionine domain-containing protein 2
9	9606.ENSP00000309142	0.965	2',5'-phosphodiesterase 12
10	9606.ENSP00000471896	0.965	Interferon regulatory factor 3
11	9606.ENSP00000380697	0.961	Interferon regulatory factor 7
12	9606.ENSP00000354394	0.960	Signal transducer and activator of transcription 1-alpha/beta
13	9606.ENSP00000357459	0.960	Double-stranded RNA-specific adenosine deaminase
14	9606.ENSP00000360869	0.960	Interferon-induced protein with tetratricopeptide repeats 1
15	9606.ENSP00000306565	0.959	Interferon-stimulated gene 20 kDa protein
16	9606.ENSP00000315768	0.959	Signal transducer and activator of transcription 2
17	9606.ENSP00000380073	0.954	Interferon regulatory factor 9
18	9606.ENSP00000333657	0.951	Interferon-induced GTP-binding protein Mx2
19	9606.ENSP00000360891	0.951	Interferon-induced protein with tetratricopeptide repeats 2
20	9606.ENSP00000245414	0.949	Interferon regulatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004540	1.000	ribonuclease activity
GO:0042802	0.942	identical protein binding
GO:0016740	0.348	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0019222	0.958	regulation of metabolic process
GO:0050896	0.955	response to stimulus
GO:0048522	0.947	positive regulation of cellular process
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0009615	0.916	response to virus
GO:0080090	0.907	regulation of primary metabolic process
GO:0051171	0.907	regulation of nitrogen compound metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0006950	0.899	response to stress
GO:0140546	0.830	defense response to symbiont
GO:0048519	0.825	negative regulation of biological process
GO:0010468	0.818	regulation of gene expression
GO:0050792	0.806	regulation of viral process
GO:0019219	0.781	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.767	regulation of RNA metabolic process
GO:0051607	0.687	defense response to virus
GO:0071704	0.658	organic substance metabolic process
GO:0044238	0.658	primary metabolic process
GO:0009893	0.655	positive regulation of metabolic process
GO:0044237	0.641	cellular metabolic process
GO:0006807	0.621	nitrogen compound metabolic process
GO:0009889	0.604	regulation of biosynthetic process
GO:0031325	0.589	positive regulation of cellular metabolic process
GO:0043170	0.568	macromolecule metabolic process
GO:0010556	0.533	regulation of macromolecule biosynthetic process
GO:0010604	0.528	positive regulation of macromolecule metabolic process
GO:0031326	0.515	regulation of cellular biosynthetic process
GO:0051173	0.512	positive regulation of nitrogen compound metabolic process
GO:2001141	0.457	regulation of RNA biosynthetic process
GO:1903900	0.429	regulation of viral life cycle
GO:0045935	0.421	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.385	negative regulation of cellular process
GO:0051716	0.377	cellular response to stimulus
GO:0051254	0.374	positive regulation of RNA metabolic process
GO:0006355	0.367	regulation of DNA-templated transcription
GO:0045069	0.358	regulation of viral genome replication
GO:0045893	0.348	positive regulation of DNA-templated transcription
GO:0006357	0.326	regulation of transcription by RNA polymerase II
GO:0048525	0.318	negative regulation of viral process
GO:0045071	0.306	negative regulation of viral genome replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.991	nuclear lumen
GO:0005829	0.976	cytosol
GO:0005739	0.584	mitochondrion
GO:0005654	0.340	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
EC:2.-.-.-	0.348	Transferases.

[back to server]