StarFunc result for job id Q05925

User Input

>input (392 residues)
MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP
AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE
QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP
DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT
KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK
ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JT82	0.383	0.378	1.034E-43	399	0.867	0.852	A0A0G2JT82.pdb.gz	A0A0G2JT82_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En1 PE=3 SV=2
2	AFDB:P82976	0.141	0.132	1.593E-6	418	0.230	0.215	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
3	AFDB:P31276	0.153	0.181	8.962E-6	330	0.207	0.245	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
4	AFDB:O08755	0.173	0.147	1.307E-3	465	0.189	0.159	O08755.pdb.gz	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
5	AFDB:O60422	0.156	0.127	9.586E-3	494	0.263	0.209	O60422.pdb.gz	ONEC3_HUMAN One cut domain family member 3 OS=Homo sapiens OX=9606 GN=ONECUT3 PE=1 SV=2
6	AFDB:Q5MD19	0.159	0.136	1.526E-2	461	0.186	0.158	Q5MD19.pdb.gz
7	PDB:4egcA	0.127	0.092	2.449E-2	539	0.031	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
8	PDB:2hi3A	0.136	0.619	4.452E-2	73	0.041	0.219	2hi3A.pdb.gz
9	AFDB:P20264	0.159	0.125	6.158E-2	500	0.189	0.148	P20264.pdb.gz	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
10	AFDB:Q4WYQ4	0.078	0.064	1.048E-1	493	0.181	0.144	Q4WYQ4.pdb.gz	Q4WYQ4_ASPFU GATA-type sexual development transcription factor NsdD OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G13870 PE=4 SV=1
11	AFDB:Q9CAA9	0.093	0.079	1.783E-1	486	0.145	0.117	Q9CAA9.pdb.gz	BH049_ARATH Transcription factor bHLH49 OS=Arabidopsis thaliana OX=3702 GN=BHLH49 PE=1 SV=1
12	AFDB:A0A0B4JD55	0.162	0.058	3.702E-1	1292	0.235	0.071	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
13	PDB:5nr5A	0.095	0.271	7.747E-1	113	0.069	0.239	5nr5A.pdb.gz
14	PDB:5aj0BZ	0.108	0.405	9.456E-1	86	0.031	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5z56L	0.111	0.125	1.609	342	0.028	0.032	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:1yioA	0.094	0.168	1.837	198	0.028	0.056	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:4ldzA	0.077	0.126	1.964	196	0.026	0.051	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
18	PDB:3femA	0.088	0.119	2.397	281	0.020	0.028	3femA.pdb.gz
19	PDB:2cjjA	0.132	0.675	2.925	63	0.026	0.159	2cjjA.pdb.gz
20	PDB:6hxgA	0.085	0.121	2.925	264	0.018	0.027	6hxgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05925	0.0	778	392	1.000	1.000	HME1_HUMAN Homeobox protein engrailed-1 OS=Homo sapiens OX=9606 GN=EN1 PE=3 SV=3
2	A0A0G2JT82	5.00e-157	449	402	0.691	0.674	A0A0G2JT82_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En1 PE=3 SV=2
3	P09065	1.69e-156	448	401	0.691	0.676	HME1_MOUSE Homeobox protein engrailed-1 OS=Mus musculus OX=10090 GN=En1 PE=2 SV=3
4	Q5BJ08	7.70e-85	261	274	0.416	0.595	Q5BJ08_DANRE Homeobox protein engrailed-like OS=Danio rerio OX=7955 GN=zgc:113499 PE=2 SV=1
5	P09066	6.79e-75	237	324	0.398	0.481	HME2_MOUSE Homeobox protein engrailed-2 OS=Mus musculus OX=10090 GN=En2 PE=2 SV=2
6	D3Z8B1	6.06e-74	235	323	0.416	0.505	D3Z8B1_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En2 PE=3 SV=1
7	P31533	1.62e-72	229	261	0.344	0.517	HME2B_DANRE Homeobox protein engrailed-2b OS=Danio rerio OX=7955 GN=eng2b PE=2 SV=2
8	P09015	3.29e-72	228	265	0.265	0.392	HME2A_DANRE Homeobox protein engrailed-2a OS=Danio rerio OX=7955 GN=eng2a PE=2 SV=2
9	Q04896	2.43e-69	220	231	0.255	0.433	HME1A_DANRE Homeobox protein engrailed-1a OS=Danio rerio OX=7955 GN=eng1a PE=2 SV=1
10	P19622	2.91e-67	218	333	0.270	0.318	HME2_HUMAN Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3
11	Q05917	7.95e-63	205	289	0.306	0.415	HME2_CHICK Homeobox protein engrailed-2 OS=Gallus gallus OX=9031 GN=EN2 PE=1 SV=2
12	P02836	1.33e-52	185	552	0.217	0.154	HMEN_DROME Segmentation polarity homeobox protein engrailed OS=Drosophila melanogaster OX=7227 GN=en PE=1 SV=2
13	P05527	7.46e-48	173	576	0.230	0.156	HMIN_DROME Homeobox protein invected OS=Drosophila melanogaster OX=7227 GN=inv PE=2 SV=2
14	P34326	5.19e-37	134	187	0.171	0.358	HM16_CAEEL Homeobox protein engrailed-like ceh-16 OS=Caenorhabditis elegans OX=6239 GN=ceh-16 PE=1 SV=3
15	Q801E0	2.57e-16	81.3	317	0.105	0.129	VAX1_DANRE Ventral anterior homeobox 1 OS=Danio rerio OX=7955 GN=vax1 PE=2 SV=1
16	P06798	3.46e-16	80.5	285	0.122	0.168	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
17	P32043	3.67e-16	79.0	222	0.092	0.162	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
18	Q5SQQ9	5.41e-16	80.5	334	0.117	0.138	VAX1_HUMAN Ventral anterior homeobox 1 OS=Homo sapiens OX=9606 GN=VAX1 PE=1 SV=1
19	Q00444	5.47e-16	78.6	222	0.092	0.162	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1
20	Q2NKI2	7.52e-16	80.1	338	0.105	0.121	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10078 DUF2316	32	16.2	Uncharacterized protein conserved in bacteria (DUF2316)
2	PF10525 Engrail_1_C_sig	4.5e-16	69.1	Engrailed homeobox C-terminal signature domain
3	PF05920 Homeobox_KN	12	17.3	Homeobox KN domain
4	PF00046 Homeodomain	5.5e-18	75.9	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365682	0.848	Transducin-like enhancer protein 1
2	9606.ENSP00000365720	0.824	Transducin-like enhancer protein 4
3	9606.ENSP00000293549	0.811	Proto-oncogene Wnt-1
4	9606.ENSP00000359319	0.795	Paired box protein Pax-2
5	9606.ENSP00000321797	0.772	Fibroblast growth factor 8
6	9606.ENSP00000297261	0.744	Sonic hedgehog protein
7	9606.ENSP00000344479	0.734	Nuclear receptor subfamily 4 group A member 2
8	9606.ENSP00000452871	0.722	Transducin-like enhancer protein 3
9	9606.ENSP00000400341	0.656	Hepatocyte nuclear factor 3-beta
10	9606.ENSP00000378733	0.648	Protein LBH
11	9606.ENSP00000339004	0.644	Forkhead box protein G1
12	9606.ENSP00000298472	0.613	Synaptic vesicular amine transporter
13	9606.ENSP00000260653	0.612	Homeobox protein SIX3
14	9606.ENSP00000453793	0.611	Homeobox protein Meis2
15	9606.ENSP00000370571	0.605	Tyrosine 3-monooxygenase
16	9606.ENSP00000297375	0.597	Homeobox protein engrailed-2
17	9606.ENSP00000230658	0.596	Insulin gene enhancer protein ISL-1
18	9606.ENSP00000404100	0.594	Paired box protein Pax-6
19	9606.ENSP00000405890	0.577	Pre-B-cell leukemia transcription factor 1
20	9606.ENSP00000477437	0.577	G protein-activated inward rectifier potassium channel 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0001067	0.976	transcription regulatory region nucleic acid binding
GO:0000976	0.974	transcription cis-regulatory region binding
GO:0000981	0.912	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.774	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0050789	0.995	regulation of biological process
GO:0048856	0.995	anatomical structure development
GO:0009987	0.990	cellular process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0048731	0.985	system development
GO:0007399	0.982	nervous system development
GO:0030154	0.948	cell differentiation
GO:0048519	0.907	negative regulation of biological process
GO:0030182	0.887	neuron differentiation
GO:0071542	0.871	dopaminergic neuron differentiation
GO:0006357	0.862	regulation of transcription by RNA polymerase II
GO:0048523	0.779	negative regulation of cellular process
GO:0050896	0.748	response to stimulus
GO:0048518	0.724	positive regulation of biological process
GO:0048522	0.643	positive regulation of cellular process
GO:0048513	0.589	animal organ development
GO:0009653	0.540	anatomical structure morphogenesis
GO:0009893	0.481	positive regulation of metabolic process
GO:0009892	0.479	negative regulation of metabolic process
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0031325	0.451	positive regulation of cellular metabolic process
GO:0009891	0.434	positive regulation of biosynthetic process
GO:0051173	0.419	positive regulation of nitrogen compound metabolic process
GO:0031328	0.407	positive regulation of cellular biosynthetic process
GO:0045893	0.397	positive regulation of DNA-templated transcription
GO:0031324	0.319	negative regulation of cellular metabolic process
GO:0010605	0.314	negative regulation of macromolecule metabolic process
GO:0051172	0.312	negative regulation of nitrogen compound metabolic process
GO:0045944	0.308	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.916	intracellular organelle lumen
GO:0031981	0.913	nuclear lumen
GO:0016020	0.901	membrane
GO:0005737	0.501	cytoplasm
GO:0005654	0.372	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]