StarFunc result for job id Q05932

User Input

>input (587 residues)
MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAG
YLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRS
YGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGE
HQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEW
PGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEE
QASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSP
PKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05932	1.000	1.000	0.000	587	1.000	1.000	Q05932.pdb.gz	FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=FPGS PE=1 SV=3
2	AFDB:M0R401	0.635	0.926	6.351E-53	397	0.535	0.791	M0R401.pdb.gz	M0R401_RAT Folylpolyglutamate synthase OS=Rattus norvegicus OX=10116 GN=Fpgs PE=3 SV=3
3	AFDB:Q8W035	0.697	0.825	2.428E-43	492	0.325	0.388	Q8W035.pdb.gz	FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS3 PE=1 SV=1
4	AFDB:F4J2K2	0.706	0.664	4.777E-43	625	0.351	0.330	F4J2K2.pdb.gz	FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS2 PE=1 SV=1
5	AFDB:Q08645	0.752	0.804	5.032E-43	548	0.346	0.370	Q08645.pdb.gz	FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET7 PE=1 SV=1
6	AFDB:O74742	0.715	0.827	2.461E-40	505	0.324	0.376	O74742.pdb.gz	FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met7 PE=2 SV=1
7	AFDB:F4K2A1	0.683	0.701	1.057E-39	571	0.351	0.361	F4K2A1.pdb.gz	FPGS1_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS1 PE=1 SV=1
8	AFDB:Q38AL2	0.640	0.745	4.600E-32	500	0.271	0.318	Q38AL2.pdb.gz	Q38AL2_TRYB2 Folylpolyglutamate-dihydrofolate synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3140 PE=3 SV=1
9	AFDB:F4JYE9	0.631	0.695	6.371E-29	530	0.230	0.255	F4JYE9.pdb.gz	DHFS_ARATH Dihydrofolate synthetase OS=Arabidopsis thaliana OX=3702 GN=DHFS PE=1 SV=1
10	AFDB:O53174	0.607	0.723	4.725E-26	487	0.213	0.257	O53174.pdb.gz	O53174_MYCTO Folylpolyglutamate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=folC PE=1 SV=1
11	PDB:1w78A	0.573	0.793	5.777E-25	414	0.216	0.307	1w78A.pdb.gz	Escherichia Coli Folc Structure Reveals an Unexpected Dihydrofolate Binding Site Providing an Attractive Target for Anti-Microbial Therapy
12	PDB:2vosA	0.598	0.768	5.414E-24	448	0.203	0.266	2vosA.pdb.gz	Structures of Mycobacterium Tuberculosisfolylpolyglutamate Synthase Complexed with Adp and Amppcp.
13	PDB:2wtzB	0.440	0.499	3.181E-11	508	0.129	0.150	2wtzB.pdb.gz	ATP-Dependent Mure Ligase in Mycobacterium Tuberculosis: Biochemical and Structural Characterisation.
14	PDB:2wtzC	0.389	0.503	3.140E-10	439	0.114	0.153	2wtzC.pdb.gz	ATP-Dependent Mure Ligase in Mycobacterium Tuberculosis: Biochemical and Structural Characterisation.
15	PDB:1gg4A	0.341	0.430	5.864E-10	439	0.128	0.171	1gg4A.pdb.gz
16	PDB:1e8cB	0.435	0.504	4.462E-9	497	0.121	0.143	1e8cB.pdb.gz	Crystal Structure of Udp-N-Acetylmuramoyl-L-Alanyl-D-Glutamate: Meso-Diaminopimelate Ligase from Escherichia Coli
17	PDB:2f00B	0.423	0.504	1.331E-8	483	0.097	0.118	2f00B.pdb.gz
18	PDB:6h5eB	0.291	0.382	2.099E-7	394	0.099	0.147	6h5eB.pdb.gz	Structural basis of cell wall peptidoglycan amidation by the GatD/MurT complex of Staphylococcus aureus.
19	PDB:2jfgA	0.392	0.507	1.216E-5	439	0.118	0.157	2jfgA.pdb.gz	Structural and functional characterization of enantiomeric glutamic acid derivatives as potential transition state analogue inhibitors of MurD ligase.
20	PDB:6pk4A	0.240	0.250	7.713E-3	559	0.090	0.095	6pk4A.pdb.gz	Coupled structural transitions enable highly cooperative regulation of human CTPS2 filaments.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AA44	0.0	907	582	0.753	0.759	A0A8I6AA44_RAT Folylpolyglutamate synthase OS=Rattus norvegicus OX=10116 GN=Fpgs PE=1 SV=1
2	M0R401	0.0	965	587	0.809	0.809	M0R401_RAT Folylpolyglutamate synthase OS=Rattus norvegicus OX=10116 GN=Fpgs PE=3 SV=3
3	P48760	0.0	982	587	0.821	0.821	FOLC_MOUSE Folylpolyglutamate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Fpgs PE=1 SV=3
4	Q05932	0.0	1202	587	1.000	1.000	FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=FPGS PE=1 SV=3
5	Q08645	4.37e-103	324	548	0.324	0.347	FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET7 PE=1 SV=1
6	F4K2A1	6.38e-98	311	571	0.365	0.375	FPGS1_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS1 PE=1 SV=1
7	Q8W035	6.09e-96	303	492	0.348	0.415	FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS3 PE=1 SV=1
8	F4J2K2	8.57e-95	305	625	0.376	0.354	FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS2 PE=1 SV=1
9	O74742	8.35e-89	285	505	0.339	0.394	FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met7 PE=2 SV=1
10	Q38AL2	5.47e-53	190	500	0.250	0.294	Q38AL2_TRYB2 Folylpolyglutamate-dihydrofolate synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3140 PE=3 SV=1
11	A0A1D8PQV5	5.26e-35	139	430	0.152	0.207	A0A1D8PQV5_CANAL Dihydrofolate synthetase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C701280CA PE=3 SV=1
12	F4JYE9	1.09e-33	137	530	0.196	0.217	DHFS_ARATH Dihydrofolate synthetase OS=Arabidopsis thaliana OX=3702 GN=DHFS PE=1 SV=1
13	Q8IE69	1.49e-32	133	522	0.126	0.142	Q8IE69_PLAF7 Dihydrofolate synthase/folylpolyglutamate synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1324800 PE=3 SV=1
14	Q12676	1.62e-31	129	427	0.169	0.232	FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FOL3 PE=1 SV=1
15	Q9UTD0	1.25e-30	126	417	0.169	0.237	FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fol3 PE=3 SV=1
16	P08192	2.00e-28	120	422	0.191	0.265	FOLC_ECOLI Dihydrofolate synthase/folylpolyglutamate synthase OS=Escherichia coli (strain K12) OX=83333 GN=folC PE=1 SV=2
17	O53174	6.85e-26	113	487	0.187	0.226	O53174_MYCTO Folylpolyglutamate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=folC PE=1 SV=1
18	P36001	3.41e-05	48.9	430	0.078	0.107	FOLC_YEAST Probable folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RMA1 PE=3 SV=1
19	P36618	0.76	34.7	299	0.036	0.070	CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc16 PE=1 SV=1
20	Q92674	1.6	34.3	756	0.048	0.037	CENPI_HUMAN Centromere protein I OS=Homo sapiens OX=9606 GN=CENPI PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02875 Mur_ligase_C	24	16.6	Mur ligase family, glutamate ligase domain
2	PF08245 Mur_ligase_M	6.2	18.2	Mur ligase middle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396308	0.992	Dihydrofolate reductase
2	9606.ENSP00000260118	0.984	Gamma-glutamyl hydrolase
3	9606.ENSP00000315644	0.980	Thymidylate synthase
4	9606.ENSP00000216605	0.972	C-1-tetrahydrofolate synthase, cytoplasmic
5	9606.ENSP00000377768	0.968	Dihydrofolate reductase 2, mitochondrial
6	9606.ENSP00000478253	0.966	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
7	9606.ENSP00000365777	0.883	Methylenetetrahydrofolate reductase
8	9606.ENSP00000419045	0.866	GTP cyclohydrolase 1
9	9606.ENSP00000380251	0.834	Nucleoside diphosphate-linked moiety X motif 19
10	9606.ENSP00000371253	0.833	Trifunctional purine biosynthetic protein adenosine-3
11	9606.ENSP00000318868	0.827	Serine hydroxymethyltransferase, cytosolic
12	9606.ENSP00000476046	0.791	mRNA-decapping enzyme 1A
13	9606.ENSP00000333667	0.777	Serine hydroxymethyltransferase, mitochondrial
14	9606.ENSP00000236959	0.774	Bifunctional purine biosynthesis protein PURH
15	9606.ENSP00000308895	0.733	Folate transporter 1
16	9606.ENSP00000361667	0.729	Dolichol kinase
17	9606.ENSP00000258874	0.717	5-formyltetrahydrofolate cyclo-ligase
18	9606.ENSP00000280665	0.703	mRNA-decapping enzyme 1B
19	9606.ENSP00000362166	0.678	Chromatin modification-related protein MEAF6
20	9606.ENSP00000377617	0.657	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004326	1.000	tetrahydrofolylpolyglutamate synthase activity
GO:0005488	0.603	binding
GO:0005515	0.344	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0044238	0.962	primary metabolic process
GO:1901564	0.927	organonitrogen compound metabolic process
GO:1901360	0.926	organic cyclic compound metabolic process
GO:0006725	0.926	cellular aromatic compound metabolic process
GO:0046483	0.925	heterocycle metabolic process
GO:0042558	0.913	pteridine-containing compound metabolic process
GO:0044281	0.891	small molecule metabolic process
GO:0034641	0.862	cellular nitrogen compound metabolic process
GO:1901576	0.776	organic substance biosynthetic process
GO:0006575	0.766	cellular modified amino acid metabolic process
GO:0044249	0.760	cellular biosynthetic process
GO:1901566	0.715	organonitrogen compound biosynthetic process
GO:0044271	0.701	cellular nitrogen compound biosynthetic process
GO:0019752	0.685	carboxylic acid metabolic process
GO:0018130	0.619	heterocycle biosynthetic process
GO:0019438	0.614	aromatic compound biosynthetic process
GO:0043648	0.614	dicarboxylic acid metabolic process
GO:1901362	0.612	organic cyclic compound biosynthetic process
GO:0006520	0.538	amino acid metabolic process
GO:1901605	0.492	alpha-amino acid metabolic process
GO:0043603	0.480	amide metabolic process
GO:0006139	0.435	nucleobase-containing compound metabolic process
GO:0006760	0.425	folic acid-containing compound metabolic process
GO:0042559	0.378	pteridine-containing compound biosynthetic process
GO:0032501	0.320	multicellular organismal process
GO:0032502	0.315	developmental process
GO:0048856	0.305	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005829	0.968	cytosol
GO:0005759	0.863	mitochondrial matrix
GO:0031981	0.339	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10580	1.000	(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + ATP + L-glutamate = (6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n+1) + ADP + H(+) + phosphate
EC:6.3.2.17	1.000	tetrahydrofolate synthase.

[back to server]