StarFunc result for job id Q05BQ5

User Input

>input (628 residues)
MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMV
GVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYA
QYQATLQNQAKTKAAVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEV
PNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGK
PLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLC
RTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQ
DGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGID
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
KLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCE
SPDLYPVGWCQLTGYQLQPPASQSSRENQSASSKQKKKAKSQQYKGHKKMTTLQLKEELL
DGEDYNFLQGASDQESNGSANFYIKQEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P5G3	0.914	0.910	0.000	631	0.978	0.973	Q6P5G3.pdb.gz	MBTD1_MOUSE MBT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mbtd1 PE=1 SV=1
2	AFDB:Q969R5	0.680	0.607	1.069E-76	705	0.546	0.487	Q969R5.pdb.gz	LMBL2_HUMAN Lethal(3)malignant brain tumor-like protein 2 OS=Homo sapiens OX=9606 GN=L3MBTL2 PE=1 SV=1
3	AFDB:Q9VK33	0.653	0.342	8.131E-64	1220	0.411	0.211	Q9VK33.pdb.gz	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
4	AFDB:Q5VUG0	0.431	0.311	8.748E-41	894	0.234	0.164	Q5VUG0.pdb.gz	SMBT2_HUMAN Scm-like with four MBT domains protein 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
5	AFDB:Q9JMD1	0.442	0.330	7.098E-39	863	0.232	0.169	Q9JMD1.pdb.gz	SMBT1_MOUSE Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1
6	AFDB:A0A024R338	0.433	0.320	2.043E-38	866	0.221	0.161	A0A024R338.pdb.gz
7	AFDB:B2D6M2	0.586	0.600	1.658E-36	612	0.209	0.214	B2D6M2.pdb.gz	LIN61_CAEEL Protein lin-61 OS=Caenorhabditis elegans OX=6239 GN=lin-61 PE=1 SV=1
8	AFDB:Q96JM7	0.250	0.208	2.568E-33	780	0.236	0.190	Q96JM7.pdb.gz	LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2
9	AFDB:Q8BLB7	0.240	0.182	1.130E-31	883	0.228	0.162	Q8BLB7.pdb.gz	LMBL3_MOUSE Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus OX=10090 GN=L3mbtl3 PE=1 SV=1
10	AFDB:Q8NA19	0.227	0.228	3.636E-31	623	0.194	0.196	Q8NA19.pdb.gz	LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2
11	PDB:7abi7	0.071	0.172	9.073E-3	236	0.033	0.089	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:7okyZ	0.080	0.113	1.977E-2	374	0.068	0.115	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
13	PDB:2ns2B	0.083	0.240	2.210E-2	172	0.040	0.145	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
14	PDB:3mp8A	0.081	0.097	2.470E-2	513	0.038	0.047	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
15	PDB:2lqnA	0.075	0.120	3.856E-2	303	0.054	0.112	2lqnA.pdb.gz
16	PDB:6tedZ	0.090	0.105	5.384E-2	510	0.065	0.080	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:7rroT	0.064	0.079	1.639E-1	452	0.046	0.064	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7ungX	0.065	0.060	2.288E-1	701	0.091	0.081	7ungX.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:6rqhS	0.070	0.071	2.859E-1	610	0.067	0.069	6rqhS.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
20	PDB:6r8yK	0.077	0.066	3.022E-1	825	0.062	0.047	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59178	0.0	674	703	0.530	0.474	LMBL2_MOUSE Lethal(3)malignant brain tumor-like protein 2 OS=Mus musculus OX=10090 GN=L3mbtl2 PE=1 SV=2
2	Q05BQ5	0.0	1318	628	1.000	1.000	MBTD1_HUMAN MBT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MBTD1 PE=1 SV=2
3	Q6P5G3	0.0	1293	631	0.979	0.975	MBTD1_MOUSE MBT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mbtd1 PE=1 SV=1
4	Q969R5	0.0	667	705	0.525	0.468	LMBL2_HUMAN Lethal(3)malignant brain tumor-like protein 2 OS=Homo sapiens OX=9606 GN=L3MBTL2 PE=1 SV=1
5	Q9VK33	3.86e-147	459	1220	0.352	0.181	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
6	Q9JMD1	1.79e-64	229	863	0.239	0.174	SMBT1_MOUSE Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1
7	Q5VUG0	1.13e-63	228	894	0.231	0.162	SMBT2_HUMAN Scm-like with four MBT domains protein 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
8	A0A669KBL2	1.15e-63	228	893	0.231	0.162	A0A669KBL2_HUMAN Scm like with four mbt domains 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
9	Q9UHJ3	4.98e-59	214	866	0.229	0.166	SMBT1_HUMAN Scm-like with four MBT domains protein 1 OS=Homo sapiens OX=9606 GN=SFMBT1 PE=1 SV=2
10	Q9Y468	1.04e-48	184	840	0.202	0.151	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
11	Q96JM7	9.02e-48	181	780	0.182	0.146	LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2
12	Q8NA19	1.36e-46	176	623	0.170	0.172	LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2
13	Q8BLB7	8.67e-46	176	883	0.177	0.126	LMBL3_MOUSE Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus OX=10090 GN=L3mbtl3 PE=1 SV=1
14	B2D6M2	6.71e-45	171	612	0.199	0.204	LIN61_CAEEL Protein lin-61 OS=Caenorhabditis elegans OX=6239 GN=lin-61 PE=1 SV=1
15	A0A571BDL9	3.80e-34	135	367	0.134	0.229	A0A571BDL9_MOUSE Scm polycomb group protein like 2 (Fragment) OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
16	Q9UQR0	3.54e-33	137	700	0.135	0.121	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
17	B1AVB1	6.26e-33	137	825	0.134	0.102	B1AVB1_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
18	B1AVB2	7.59e-33	137	827	0.134	0.102	B1AVB2_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
19	B1AVB4	1.02e-32	136	845	0.134	0.099	B1AVB4_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
20	Q8BYC8	1.19e-32	136	845	0.134	0.099	Q8BYC8_MOUSE Scm polycomb group protein-like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	2.7e+02	13.3	C1 domain
2	PF02820 MBT	4.9e-88	300.8	mbt repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001826

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004254	0.935	K(lysine) acetyltransferase 5
2	60711.ENSCSAP00000006608	0.864	YY1 transcription factor
3	60711.ENSCSAP00000001672	0.827	Polycomb group ring finger 6
4	60711.ENSCSAP00000000575	0.789	YEATS domain containing 4
5	60711.ENSCSAP00000005798	0.776	Ring finger protein 1
6	60711.ENSCSAP00000009042	0.776	Ring finger protein 2
7	60711.ENSCSAP00000007719	0.743	RING1 and YY1 binding protein
8	60711.ENSCSAP00000003747	0.724	E2F transcription factor 6
9	60711.ENSCSAP00000017704	0.724	annotation not available
10	60711.ENSCSAP00000016906	0.720	MYST/Esa1-associated factor 6
11	60711.ENSCSAP00000016858	0.709	Sex comb on midleg homolog 1 (Drosophila)
12	60711.ENSCSAP00000010853	0.708	Sex comb on midleg-like 2 (Drosophila)
13	60711.ENSCSAP00000012169	0.685	MRG/MORF4L binding protein
14	60711.ENSCSAP00000003367	0.682	Uncharacterized protein
15	60711.ENSCSAP00000016940	0.681	Polyhomeotic homolog 2 (Drosophila)
16	60711.ENSCSAP00000004350	0.673	Pumilio RNA-binding family member 2
17	60711.ENSCSAP00000017450	0.655	Dual specificity phosphatase 14
18	60711.ENSCSAP00000004092	0.651	MGA, MAX dimerization protein
19	60711.ENSCSAP00000008883	0.641	Chromosome X open reading frame 67
20	60711.ENSCSAP00000001818	0.637	Sperm associated antigen 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.989	regulation of metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0050794	0.975	regulation of cellular process
GO:0071704	0.969	organic substance metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0044238	0.967	primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0009987	0.961	cellular process
GO:0006807	0.951	nitrogen compound metabolic process
GO:0016570	0.940	histone modification
GO:0048518	0.868	positive regulation of biological process
GO:0019219	0.855	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.804	positive regulation of cellular process
GO:0010468	0.715	regulation of gene expression
GO:0032502	0.704	developmental process
GO:0048856	0.672	anatomical structure development
GO:0051173	0.669	positive regulation of nitrogen compound metabolic process
GO:0010604	0.669	positive regulation of macromolecule metabolic process
GO:0031325	0.582	positive regulation of cellular metabolic process
GO:0048519	0.568	negative regulation of biological process
GO:0032501	0.536	multicellular organismal process
GO:0007275	0.527	multicellular organism development
GO:0010556	0.494	regulation of macromolecule biosynthetic process
GO:0031326	0.482	regulation of cellular biosynthetic process
GO:0045935	0.467	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.466	regulation of DNA-templated transcription
GO:0048583	0.456	regulation of response to stimulus
GO:0009892	0.446	negative regulation of metabolic process
GO:0044237	0.441	cellular metabolic process
GO:0051052	0.430	regulation of DNA metabolic process
GO:0010605	0.420	negative regulation of macromolecule metabolic process
GO:0048584	0.396	positive regulation of response to stimulus
GO:0050896	0.392	response to stimulus
GO:0080134	0.391	regulation of response to stress
GO:2001020	0.379	regulation of response to DNA damage stimulus
GO:0043543	0.363	protein acylation
GO:0048731	0.358	system development
GO:0001501	0.354	skeletal system development
GO:0048523	0.353	negative regulation of cellular process
GO:0018393	0.336	internal peptidyl-lysine acetylation
GO:0010569	0.335	regulation of double-strand break repair via homologous recombination
GO:0045911	0.335	positive regulation of DNA recombination
GO:0043967	0.334	histone H4 acetylation
GO:2000781	0.334	positive regulation of double-strand break repair
GO:0031324	0.317	negative regulation of cellular metabolic process
GO:0051726	0.306	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0005634	0.988	nucleus
GO:0005694	0.987	chromosome
GO:0031248	0.986	protein acetyltransferase complex
GO:0000123	0.984	histone acetyltransferase complex
GO:0043189	0.951	H4/H2A histone acetyltransferase complex
GO:0005654	0.931	nucleoplasm
GO:0032993	0.887	protein-DNA complex
GO:0000786	0.878	nucleosome
GO:0035267	0.877	NuA4 histone acetyltransferase complex
GO:0005737	0.317	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]