StarFunc result for job id Q05BV3

User Input

>input (1969 residues)
MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGH
SDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQR
LVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC
GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGI
FSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGT
QDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALI
ARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDG
TYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRM
PGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYG
IIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLK
DAVHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEK
QKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQ
RFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAVDF
SADGKRLASVGIDDSHTVVLWDWKKGEKLSIARGSKDKIFVVKMNPYVPDKLITAGIKHM
KFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIFLVKTVK
AHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPS
IRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK
TLRIWDLSPSHCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHH
RKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLL
QVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASC
LTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTD
MSLMVWTNEMEGYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALSTNIRPMLG
IKPHLQQKEPSIDERPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELIFGYRGRDCRNNV
HYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDS
ADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRW
QEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDA
RMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTG
GKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRNAEIIEVGE
KNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAART
VCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENS
VDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDH
AAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPC
PEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCVHTPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05BV3	1.000	1.000	0.000	1969	1.000	1.000	Q05BV3.pdb.gz	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
2	AFDB:Q96KV7	0.269	0.300	6.377E-71	1748	0.136	0.153	Q96KV7.pdb.gz	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
3	AFDB:O95834	0.293	0.876	8.683E-61	649	0.116	0.353	O95834.pdb.gz	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
4	AFDB:A0A0R4INC0	0.294	0.683	2.795E-60	840	0.109	0.255	A0A0R4INC0.pdb.gz
5	AFDB:B5MBZ0	0.295	0.581	5.841E-59	992	0.108	0.215	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
6	AFDB:O00423	0.293	0.701	8.491E-59	815	0.109	0.264	O00423.pdb.gz	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
7	AFDB:Q3UMY5	0.292	0.574	1.340E-57	988	0.108	0.216	Q3UMY5.pdb.gz	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
8	AFDB:Q32P44	0.293	0.634	4.071E-56	896	0.111	0.244	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
9	AFDB:Q9VUI3	0.284	0.513	9.050E-48	1076	0.085	0.156	Q9VUI3.pdb.gz	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
10	AFDB:O45487	0.285	0.620	3.434E-45	891	0.074	0.163	O45487.pdb.gz	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
11	PDB:7rroe	0.253	0.768	6.292E-30	610	0.061	0.198	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:6jp6A	0.100	0.158	6.680E-27	998	0.071	0.140	6jp6A.pdb.gz
13	PDB:7mqaLQ	0.098	0.213	1.412E-26	830	0.057	0.136	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:1nr0A	0.240	0.684	6.304E-26	610	0.055	0.177	1nr0A.pdb.gz
15	PDB:7mq8LR	0.218	0.481	1.332E-25	773	0.049	0.124	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7mq8LO	0.108	0.229	1.606E-25	848	0.056	0.131	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mqaLO	0.089	0.200	1.764E-25	819	0.056	0.136	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7ajuUL	0.208	0.459	5.170E-25	779	0.048	0.122	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:3sfzA	0.075	0.125	7.516E-25	1133	0.065	0.113	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
20	PDB:1pguB	0.217	0.597	5.112E-24	608	0.049	0.158	1pguB.pdb.gz	The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05BV3	0.0	4077	1969	1.000	1.000	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
2	Q6P6T4	5.47e-117	388	649	0.120	0.364	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
3	O95834	1.55e-114	381	649	0.118	0.359	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
4	A0A2R8RMY7	3.18e-114	386	817	0.112	0.269	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
5	E7EXY5	3.23e-114	385	813	0.112	0.271	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
6	Q05BC3	1.21e-112	381	814	0.112	0.270	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
7	O00423	2.41e-112	380	815	0.112	0.270	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
8	Q9HC35	1.24e-103	359	981	0.110	0.221	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
9	B5MBZ0	1.25e-103	360	992	0.110	0.219	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
10	Q3UMY5	9.53e-101	351	988	0.107	0.214	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
11	Q32P44	2.37e-90	318	896	0.106	0.233	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
12	A0A0C4DGQ7	1.44e-60	217	427	0.070	0.323	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
13	Q9VUI3	3.76e-56	216	1076	0.088	0.162	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
14	C4ALD8	2.06e-44	178	888	0.079	0.175	C4ALD8_CAEEL HELP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
15	O45487	2.64e-44	177	891	0.079	0.174	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
16	Q96KV7	6.82e-38	159	1748	0.145	0.163	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
17	Q96MT7	2.58e-30	134	1854	0.069	0.073	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
18	E9Q5M6	5.62e-27	123	1843	0.059	0.063	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
19	A8IRK7	2.62e-23	110	815	0.060	0.145	CF251_CHLRE Cilia- and flagella-associated protein 251 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP251 PE=1 SV=1
20	A8ILK1	4.43e-20	99.4	615	0.054	0.174	CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4e-32	123.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04053 Coatomer_WDAD	1.2	19.7	Coatomer WD associated region
3	PF02239 Cytochrom_D1	1.7	18.7	Cytochrome D1 heme domain
4	PF20138 DUF6528	1.8	18.9	Family of unknown function (DUF6528)
5	PF11768 Frtz	3	17.7	WD repeat-containing and planar cell polarity effector protein Fritz
6	PF16529 Ge1_WD40	0.078	23.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
7	PF03451 HELP	2.4e-53	189.2	HELP motif
8	PF20426 NBCH_WD40	0.0015	29.1	Neurobeachin beta propeller domain
9	PF08801 Nucleoporin_N	0.053	23.9	Nup133 N terminal like
10	PF11715 Nup160	2.8e+02	11.6	Nucleoporin Nup120/160
11	PF07676 PD40	58	15.1	WD40-like Beta Propeller Repeat
12	PF00400 WD40	3.1e-62	216.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219478	0.735	Zinc finger protein 500
2	9606.ENSP00000381773	0.725	DNA topoisomerase 3-beta-1
3	9606.ENSP00000340467	0.708	Capping protein, Arp2/3 and myosin-I linker protein 3
4	9606.ENSP00000268184	0.704	CREB-regulated transcription coactivator 3
5	9606.ENSP00000355523	0.700	Regulator of G-protein signaling 7
6	9606.ENSP00000254488	0.698	Sodium- and chloride-dependent GABA transporter 3
7	9606.ENSP00000364361	0.684	Mitogen-activated protein kinase kinase kinase 20
8	9606.ENSP00000282878	0.683	Ras-related protein Rab-3C
9	9606.ENSP00000452414	0.676	Protein tyrosine phosphatase, non-receptor type 21
10	9606.ENSP00000380479	0.669	ELAV-like protein 2
11	9606.ENSP00000345502	0.667	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
12	9606.ENSP00000369604	0.626	F-box only protein 16
13	9606.ENSP00000482306	0.623	Tetratricopeptide repeat protein 8
14	9606.ENSP00000251038	0.612	Zinc finger CCCH domain-containing protein 14
15	9606.ENSP00000345672	0.572	Cathepsin B
16	9606.ENSP00000339260	0.554	Sodium- and chloride-dependent GABA transporter 2
17	9606.ENSP00000377176	0.538	Spermatogenesis-associated protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.891	biological regulation
GO:0050794	0.877	regulation of cellular process
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0043229	0.969	intracellular organelle
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0031982	0.848	vesicle
GO:0005576	0.844	extracellular region
GO:0043228	0.836	non-membrane-bounded organelle
GO:0005737	0.835	cytoplasm
GO:0043232	0.834	intracellular non-membrane-bounded organelle
GO:0005634	0.794	nucleus
GO:0043230	0.774	extracellular organelle
GO:0070062	0.743	extracellular exosome
GO:0005829	0.517	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]