StarFunc result for job id Q05D32

User Input

>input (466 residues)
MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGST
PKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHV
KQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLD
MEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYS
SAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVH
CSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLL
NILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPI
ESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5Q8	0.562	0.562	5.493E-74	466	1.000	1.000	A0A024R5Q8.pdb.gz
2	AFDB:Q9LYI7	0.446	0.677	9.634E-32	305	0.262	0.400	Q9LYI7.pdb.gz	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
3	PDB:5it0A	0.204	0.234	2.432E-2	396	0.073	0.086	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
4	PDB:1te2A	0.169	0.331	6.268E-2	218	0.036	0.078	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
5	PDB:7ef7A	0.175	0.325	6.676E-2	236	0.043	0.085	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
6	PDB:3l5kA	0.176	0.322	8.594E-2	233	0.039	0.077	3l5kA.pdb.gz
7	PDB:4g9bA	0.197	0.376	9.751E-2	227	0.045	0.093	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
8	PDB:2b0cA	0.218	0.460	1.255E-1	199	0.056	0.131	2b0cA.pdb.gz	The 2.0A crystal structure of the putative phosphatase from Escherichia coli
9	PDB:4uauA	0.177	0.338	1.337E-1	226	0.032	0.066	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
10	PDB:2w4mA	0.193	0.335	1.517E-1	250	0.032	0.060	2w4mA.pdb.gz
11	PDB:3gygB	0.166	0.300	1.721E-1	230	0.056	0.113	3gygB.pdb.gz	Crystal structure of yhjK (haloacid dehalogenase-like hydrolase protein) from Bacillus subtilis
12	PDB:3k1zA	0.192	0.350	1.833E-1	241	0.034	0.066	3k1zA.pdb.gz
13	AFDB:Q7Z6P3	0.116	0.068	1.886E-1	1021	0.133	0.061	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
14	AFDB:Q9BUV0	0.105	0.126	2.428E-1	290	0.088	0.141	Q9BUV0.pdb.gz	RSRP1_HUMAN Arginine/serine-rich protein 1 OS=Homo sapiens OX=9606 GN=RSRP1 PE=1 SV=2
15	AFDB:E7EYK9	0.054	0.057	5.516E-1	420	0.094	0.105	E7EYK9.pdb.gz
16	AFDB:Q4W5Z4	0.075	0.044	1.037	877	0.109	0.058	Q4W5Z4.pdb.gz	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
17	AFDB:Q9FGW5	0.052	0.042	1.176	612	0.107	0.082	Q9FGW5.pdb.gz	CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana OX=3702 GN=CDKG1 PE=1 SV=1
18	AFDB:Q9H5H4	0.059	0.052	1.253	540	0.069	0.059	Q9H5H4.pdb.gz	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
19	AFDB:G3XKQ9	0.061	0.067	1.335	394	0.077	0.091	G3XKQ9.pdb.gz	LAX2_ORYSJ Protein LAX PANICLE 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LAX2 PE=1 SV=1
20	AFDB:O61735	0.087	0.046	1.335	1027	0.097	0.044	O61735.pdb.gz	CLOCK_DROME Circadian locomoter output cycles protein kaput OS=Drosophila melanogaster OX=7227 GN=Clk PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05D32	0.0	961	466	1.000	1.000	CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2
2	Q8BG15	0.0	932	465	0.972	0.974	CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus OX=10090 GN=Ctdspl2 PE=1 SV=1
3	H0YMH7	6.84e-114	333	165	0.354	1.000	H0YMH7_HUMAN CTD small phosphatase like 2 (Fragment) OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=1
4	H0YNW9	7.96e-76	234	117	0.251	1.000	H0YNW9_HUMAN CTD small phosphatase like 2 (Fragment) OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=1
5	Q9LYI7	4.36e-75	239	305	0.247	0.377	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
6	H0YNU2	1.71e-56	184	92	0.197	1.000	H0YNU2_HUMAN CTD small phosphatase like 2 (Fragment) OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=1
7	F4KHG9	1.56e-52	185	456	0.206	0.211	F4KHG9_ARATH SCP1-like small phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=SSP4 PE=4 SV=1
8	F4JQR6	4.19e-52	184	446	0.206	0.215	F4JQR6_ARATH SCP1-like small phosphatase 4b OS=Arabidopsis thaliana OX=3702 GN=SSP4B PE=4 SV=1
9	Q07949	2.09e-46	167	397	0.172	0.202	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
10	P58465	6.35e-46	162	276	0.170	0.286	CTDSL_MOUSE CTD small phosphatase-like protein OS=Mus musculus OX=10090 GN=Ctdspl PE=2 SV=3
11	O15194	1.63e-45	161	276	0.170	0.286	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
12	M9PFN0	2.14e-45	163	352	0.180	0.239	HZG_DROME Phosphatase Herzog OS=Drosophila melanogaster OX=7227 GN=hzg PE=1 SV=1
13	Q5A7R0	7.55e-45	164	441	0.172	0.181	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
14	Q57ZA0	1.75e-44	162	423	0.227	0.251	Q57ZA0_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1170 PE=4 SV=1
15	Q07800	2.84e-44	162	427	0.167	0.183	PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR1 PE=1 SV=1
16	H7C1Z7	3.51e-44	157	262	0.172	0.305	H7C1Z7_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
17	Q9GZU7	3.71e-44	157	261	0.161	0.287	CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
18	P58466	5.02e-44	157	261	0.161	0.287	CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus OX=10090 GN=Ctdsp1 PE=1 SV=1
19	Q6P3I6	9.41e-44	156	258	0.167	0.302	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
20	Q8BX07	1.10e-43	156	270	0.163	0.281	CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus OX=10090 GN=Ctdsp2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03031 NIF	2.6e-52	188.2	NLI interacting factor-like phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266529	0.713	Zinc finger CCHC-type and RNA binding motif containing 1
2	9606.ENSP00000374484	0.636	Transmembrane protein 87A
3	9606.ENSP00000302586	0.625	Kelch repeat and BTB domain containing 2
4	9606.ENSP00000296786	0.621	Ubiquitin-like domain-containing CTD phosphatase 1
5	9606.ENSP00000381270	0.617	Protein broad-minded
6	9606.ENSP00000253193	0.611	Low-density lipoprotein receptor-related protein 3
7	9606.ENSP00000443191	0.567	Kelch-like protein 13
8	9606.ENSP00000268835	0.544	Phosphoribosyl pyrophosphate synthase-associated protein 2
9	9606.ENSP00000400646	0.535	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
10	9606.ENSP00000303434	0.529	Ubiquitin carboxyl-terminal hydrolase 38
11	9606.ENSP00000368199	0.525	Pyroglutamyl-peptidase 1-like protein
12	9606.ENSP00000302647	0.521	Ral GTPase-activating protein subunit alpha-1
13	9606.ENSP00000233055	0.517	WD repeat and FYVE domain-containing protein 1
14	9606.ENSP00000358042	0.516	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
15	9606.ENSP00000354583	0.513	Microfibrillar-associated protein 3-like
16	9606.ENSP00000363389	0.509	Serine/threonine-protein kinase PDIK1L
17	9606.ENSP00000268989	0.507	Small G protein signaling modulator 2
18	9606.ENSP00000377969	0.505	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004722	0.999	protein serine/threonine phosphatase activity
GO:0005515	0.970	protein binding
GO:0008420	0.959	RNA polymerase II CTD heptapeptide repeat phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.974	macromolecule metabolic process
GO:0016311	0.963	dephosphorylation
GO:0006810	0.949	transport
GO:0006470	0.949	protein dephosphorylation
GO:0048522	0.945	positive regulation of cellular process
GO:0090092	0.913	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0060341	0.903	regulation of cellular localization
GO:0046907	0.903	intracellular transport
GO:0090288	0.900	negative regulation of cellular response to growth factor stimulus
GO:0030510	0.896	regulation of BMP signaling pathway
GO:0048523	0.868	negative regulation of cellular process
GO:0009968	0.864	negative regulation of signal transduction
GO:0006913	0.862	nucleocytoplasmic transport
GO:0045184	0.853	establishment of protein localization
GO:0051168	0.832	nuclear export
GO:0090101	0.832	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032880	0.818	regulation of protein localization
GO:0006886	0.805	intracellular protein transport
GO:0030514	0.799	negative regulation of BMP signaling pathway
GO:0046822	0.769	regulation of nucleocytoplasmic transport
GO:0033157	0.766	regulation of intracellular protein transport
GO:0046825	0.745	regulation of protein export from nucleus
GO:0006611	0.706	protein export from nucleus
GO:1903829	0.643	positive regulation of protein localization
GO:0051050	0.606	positive regulation of transport
GO:1904951	0.555	positive regulation of establishment of protein localization
GO:0051222	0.522	positive regulation of protein transport
GO:0032388	0.337	positive regulation of intracellular transport
GO:0046824	0.332	positive regulation of nucleocytoplasmic transport
GO:0090316	0.321	positive regulation of intracellular protein transport
GO:0019222	0.314	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.435	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	0.999	protein-serine/threonine phosphatase.

[back to server]