StarFunc result for job id Q05DH4

User Input

>input (1040 residues)
MMSSVSTESKLQQAVSLQGVDPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDE
ASAVQNYVEHMLFLLIEEQAKDAAMGPILEFVVSENIMEKLFLWSLRREFTDETKIEQLK
MYEMLVTQSHQPLLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSIL
ELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLFIMSLSAENTMVAHHIVENT
YFCPVLATGLSGLYSSLPTKLEEKGEEWHCLLKDDWLLLPSLVQFMNSLEFCNAVIQVAH
PLIRNQLVNYIYNGFLVPVLAPALHKVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFIL
LHQHENVHILDTLTSRINTPFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLIPCNHMMLS
QRWAVKERDCYSVSAAKLLALTPVCCSSGITLTLGNQERDYILWSKCMHDTSGPVERPFP
EAFSESACIVEYGKALDISYLQYLWEAHTNILRCMRDCRVWSALYDGDSPDPEMFLQSLT
EEGSVSSACPVFGLPQQLPRKTGPQLAPRKDKSQTELEWDDSYDTGISSGADVGSPGPYD
DLEVSGPPAPIDPPKHIQEMKKNALLLFKGSYIEESDFQDDVMVYRLCAEKDSEDMKDSQ
EEAARPPAEAQAEVQSVPINNGPLLSTQPETDSEEEWNRDNSDPFHSEPKEPKQEREPEA
APESNSELASPAPEAEHSSNLTAAHPESEELIAQYDQIIKELDSGAEGLMEQNYPTPDPL
LLTKEEEGKEESKGEKEKEGKKELEDEEDDFDSFIAEMPAVETVPSPFVGRDEAAFASRH
PVRTQSTPFTGPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMV
FQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMSDMTPAALTKDPIQ
EASRTGSGKNLLDGPPRVLQPFLTHRTKVAEAPPNLPLPVRNPMLAAALFPEFLKELAAL
AQEHSILCYKILGDFEDSCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05DH4	1.000	1.000	0.000	1040	1.000	1.000	Q05DH4.pdb.gz	FHI1A_HUMAN FHF complex subunit HOOK-interacting protein 1A OS=Homo sapiens OX=9606 GN=FHIP1A PE=1 SV=2
2	AFDB:Q961B0	0.168	0.164	3.183E-5	1067	0.118	0.115	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
3	AFDB:F4J8G7	0.177	0.105	8.046E-4	2138	0.132	0.064	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
4	AFDB:E1C2U2	0.134	0.074	2.820E-3	2326	0.120	0.054	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
5	AFDB:Q9VAS9	0.156	0.083	5.179E-3	2417	0.107	0.046	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
6	PDB:2q5dB	0.134	0.154	5.374E-3	845	0.061	0.075	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
7	AFDB:Q1LVF3	0.102	0.095	5.588E-3	1180	0.119	0.105	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
8	PDB:1qgkA	0.143	0.162	7.859E-3	876	0.054	0.064	1qgkA.pdb.gz
9	PDB:2xwuB	0.146	0.163	7.859E-3	910	0.065	0.075	2xwuB.pdb.gz
10	PDB:1wa5B	0.136	0.240	1.288E-2	466	0.043	0.097	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
11	PDB:6n1zA	0.179	0.191	1.390E-2	961	0.053	0.057	6n1zA.pdb.gz
12	PDB:7q2xD	0.093	0.096	1.443E-2	994	0.058	0.060	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
13	AFDB:E9PD50	0.097	0.090	1.445E-2	1170	0.113	0.100	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
14	AFDB:Q92540	0.114	0.108	1.445E-2	1137	0.112	0.102	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
15	PDB:4hm9A	0.177	0.306	1.499E-2	511	0.043	0.088	4hm9A.pdb.gz
16	AFDB:Q8WYP5	0.105	0.073	2.034E-2	2266	0.128	0.059	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
17	PDB:5uwuC	0.133	0.138	2.552E-2	998	0.058	0.060	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
18	AFDB:Q8CJF7	0.075	0.044	2.555E-2	2243	0.120	0.056	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
19	PDB:1b3uA	0.118	0.172	2.754E-2	588	0.059	0.104	1b3uA.pdb.gz
20	PDB:5tbkA	0.160	0.339	3.086E-2	417	0.051	0.127	5tbkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05DH4	0.0	2140	1040	1.000	1.000	FHI1A_HUMAN FHF complex subunit HOOK-interacting protein 1A OS=Homo sapiens OX=9606 GN=FHIP1A PE=1 SV=2
2	Q8N612	3.16e-157	492	972	0.265	0.284	FHI1B_HUMAN FHF complex subunit HOOK-interacting protein 1B OS=Homo sapiens OX=9606 GN=FHIP1B PE=1 SV=3
3	Q5W0V3	6.79e-08	59.3	765	0.053	0.072	FHI2A_HUMAN FHF complex subunit HOOK interacting protein 2A OS=Homo sapiens OX=9606 GN=FHIP2A PE=1 SV=1
4	Q387F7	1.4	35.4	740	0.038	0.054	Q387F7_TRYB2 Translin-associated factor X-interacting protein 1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0190 PE=4 SV=1
5	Q9S9P0	3.1	34.3	990	0.049	0.052	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
6	Q57Z48	7.3	32.7	304	0.022	0.076	Q57Z48_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.260 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19314 DUF5917	1.7e-29	113.1	Family of unknown function (DUF5917)
2	PF19311 KELAA	3.6e-05	34.6	KELAA motif
3	PF10257 RAI16-like	3.3e-92	320.8	Retinoic acid induced 16-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413196

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378152	0.947	AKT-interacting protein
2	9606.ENSP00000305699	0.805	Protein Hook homolog 3
3	9606.ENSP00000349629	0.611	Lipopolysaccharide-responsive and beige-like anchor protein
4	9606.ENSP00000216218	0.593	Hsc70-interacting protein
5	9606.ENSP00000417711	0.521	Protein FAM205A
6	9606.ENSP00000380671	0.519	Single-pass membrane protein with coiled-coil domains 1
7	9606.ENSP00000321426	0.518	Olfactory receptor 52E4
8	9606.ENSP00000360252	0.500	Protein Hook homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008104	0.976	protein localization
GO:1905719	0.365	protein localization to perinuclear region of cytoplasm
GO:0071840	0.363	cellular component organization or biogenesis
GO:0065007	0.328	biological regulation
GO:0016043	0.304	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.980	organelle
GO:0043227	0.960	membrane-bounded organelle
GO:0043229	0.956	intracellular organelle
GO:0032991	0.954	protein-containing complex
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0016020	0.825	membrane
GO:0012505	0.589	endomembrane system
GO:0005829	0.448	cytosol
GO:0005794	0.306	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]