StarFunc result for job id Q06055

User Input

>input (141 residues)
MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
TSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56383	0.658	0.639	1.336E-15	146	0.915	0.884	P56383.pdb.gz	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
2	AFDB:P07926	0.640	0.632	2.967E-15	143	0.879	0.867	P07926.pdb.gz	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
3	AFDB:Q06645	0.625	0.648	1.113E-12	136	0.695	0.721	Q06645.pdb.gz	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
4	AFDB:P48201	0.642	0.637	1.247E-12	142	0.752	0.746	P48201.pdb.gz	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
5	AFDB:P05496	0.684	0.707	4.126E-12	136	0.681	0.706	P05496.pdb.gz	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
6	AFDB:Q6NN09	0.579	0.591	1.461E-9	138	0.645	0.659	Q6NN09.pdb.gz	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
7	AFDB:P16000	0.553	0.545	1.618E-6	143	0.326	0.322	P16000.pdb.gz	ATP9_EMENI ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atp9 PE=3 SV=2
8	AFDB:O43937	0.525	0.617	5.058E-6	118	0.340	0.407	O43937.pdb.gz	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
9	AFDB:P00842	0.550	0.528	5.058E-6	147	0.355	0.340	P00842.pdb.gz	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
10	AFDB:Q38C84	0.559	0.664	8.448E-6	118	0.326	0.390	Q38C84.pdb.gz	Q38C84_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6340 PE=1 SV=1
11	PDB:2wpdJ	0.488	0.876	1.252E-4	76	0.319	0.592	2wpdJ.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
12	PDB:8ap9P	0.473	0.843	4.145E-4	78	0.277	0.500	8ap9P.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
13	PDB:3zk1A	0.507	0.776	2.718E-3	89	0.170	0.270	3zk1A.pdb.gz	A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
14	PDB:1a91A	0.275	0.442	9.627E-1	79	0.106	0.190	1a91A.pdb.gz
15	PDB:7nsuD	0.373	0.147	1.435	420	0.043	0.014	7nsuD.pdb.gz
16	PDB:4q4aA	0.298	0.098	2.019	572	0.057	0.014	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
17	PDB:5ew5A	0.234	0.097	2.685	490	0.071	0.020	5ew5A.pdb.gz
18	PDB:4k1nA	0.218	0.076	2.843	520	0.071	0.019	4k1nA.pdb.gz
19	PDB:6wlw0	0.433	0.307	2.843	204	0.156	0.108	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
20	PDB:7sqcO1	0.262	0.079	2.843	673	0.092	0.019	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q06055	8.63e-96	274	141	1.000	1.000	AT5G2_HUMAN ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC2 PE=1 SV=1
2	Q06646	5.93e-85	246	141	0.901	0.901	AT5G2_RAT ATP synthase F(0) complex subunit C2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc2 PE=1 SV=1
3	P56383	2.67e-84	245	146	0.915	0.884	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
4	P07926	3.68e-80	234	143	0.879	0.867	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
5	Q3ZC75	2.89e-67	202	141	0.723	0.723	AT5G3_BOVIN ATP synthase F(0) complex subunit C3, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC3 PE=2 SV=1
6	P56384	2.05e-66	199	141	0.730	0.730	AT5G3_MOUSE ATP synthase F(0) complex subunit C3, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc3 PE=1 SV=1
7	P48201	2.61e-66	199	142	0.752	0.746	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
8	Q71S46	2.61e-66	199	142	0.752	0.746	AT5G3_RAT ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1
9	P32876	4.26e-61	186	136	0.709	0.735	AT5G1_BOVIN ATP synthase F(0) complex subunit C1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC1 PE=1 SV=1
10	Q9CR84	4.91e-61	186	136	0.709	0.735	AT5G1_MOUSE ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc1 PE=1 SV=1
11	Q06645	7.43e-60	182	136	0.709	0.735	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
12	P05496	8.88e-57	175	136	0.674	0.699	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
13	Q6NN09	4.96e-54	168	138	0.624	0.638	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
14	P61829	8.86e-24	89.7	76	0.319	0.592	ATP9_YEAST ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OLI1 PE=1 SV=1
15	O43937	1.42e-23	90.5	118	0.326	0.390	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
16	Q385P0	1.42e-23	90.5	118	0.326	0.390	Q385P0_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2950 PE=3 SV=1
17	Q38C84	1.43e-23	90.5	118	0.326	0.390	Q38C84_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6340 PE=1 SV=1
18	Q57WQ3	9.40e-23	88.2	117	0.333	0.402	Q57WQ3_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.800 PE=3 SV=1
19	P00842	1.23e-22	89.0	147	0.397	0.381	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
20	Q37315	3.41e-18	75.9	88	0.255	0.409	ATP9_DICDI ATP synthase subunit 9, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00137 ATP-synt_C	4.4e-07	41.5	ATP synthase subunit C
2	PF08691 Nse5	5.5e+02	10.6	DNA repair proteins Nse5 and Nse6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377878

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301587	0.989	ATP synthase subunit d, mitochondrial
2	9606.ENSP00000349142	0.986	ATP synthase subunit gamma, mitochondrial
3	9606.ENSP00000354632	0.986	ATP synthase subunit a
4	9606.ENSP00000358737	0.985	ATP synthase F(0) complex subunit B1, mitochondrial
5	9606.ENSP00000381736	0.980	ATP synthase subunit alpha, mitochondrial
6	9606.ENSP00000215375	0.979	ATP synthase subunit delta, mitochondrial
7	9606.ENSP00000262030	0.979	ATP synthase subunit beta, mitochondrial
8	9606.ENSP00000290299	0.973	ATP synthase subunit O, mitochondrial
9	9606.ENSP00000300688	0.964	ATP synthase subunit g, mitochondrial
10	9606.ENSP00000389649	0.961	ATP synthase-coupling factor 6, mitochondrial
11	9606.ENSP00000292475	0.948	ATP synthase subunit f, mitochondrial
12	9606.ENSP00000306003	0.942	ATP synthase subunit e, mitochondrial
13	9606.ENSP00000243997	0.929	ATP synthase subunit epsilon, mitochondrial
14	9606.ENSP00000355265	0.892	ATP synthase protein 8
15	9606.ENSP00000421076	0.881	ATP synthase subunit g 2, mitochondrial
16	9606.ENSP00000394107	0.866	annotation not available
17	9606.ENSP00000417378	0.862	ATPase H+ transporting V1 subunit F
18	9606.ENSP00000358840	0.854	Up-regulated during skeletal muscle growth protein 5
19	9606.ENSP00000272238	0.840	V-type proton ATPase subunit C 2
20	9606.ENSP00000253413	0.833	V-type proton ATPase subunit E 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.937	transmembrane transporter activity
GO:0015075	0.844	monoatomic ion transmembrane transporter activity
GO:0015078	0.610	proton transmembrane transporter activity
GO:0003824	0.582	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0043933	0.979	protein-containing complex organization
GO:0065003	0.966	protein-containing complex assembly
GO:0010033	0.898	response to organic substance
GO:1901700	0.877	response to oxygen-containing compound
GO:0046931	0.836	pore complex assembly
GO:0044237	0.585	cellular metabolic process
GO:0071704	0.440	organic substance metabolic process
GO:0044238	0.430	primary metabolic process
GO:1901698	0.352	response to nitrogen compound
GO:0006807	0.334	nitrogen compound metabolic process
GO:0044271	0.315	cellular nitrogen compound biosynthetic process
GO:0097305	0.306	response to alcohol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.998	organelle membrane
GO:0031975	0.997	envelope
GO:0005739	0.997	mitochondrion
GO:0031966	0.989	mitochondrial membrane
GO:0032991	0.945	protein-containing complex
GO:0005743	0.852	mitochondrial inner membrane
GO:0098796	0.836	membrane protein complex
GO:1902494	0.714	catalytic complex
GO:0098798	0.704	mitochondrial protein-containing complex
GO:0098800	0.688	inner mitochondrial membrane protein complex
GO:0016469	0.522	proton-transporting two-sector ATPase complex
GO:0098588	0.486	bounding membrane of organelle
GO:0019867	0.371	outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]