StarFunc result for job id Q06136

User Input

>input (332 residues)
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFIT
LVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVN
CAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGL
FGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISE
TTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLF
RTIALFYLGSFDSIVRRCMMQREKSENADKTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06136	1.000	1.000	1.641E-66	332	1.000	1.000	Q06136.pdb.gz	KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens OX=9606 GN=KDSR PE=1 SV=1
2	AFDB:F1QWW8	0.994	0.919	2.532E-59	359	0.810	0.749	F1QWW8.pdb.gz	F1QWW8_DANRE 3-dehydrosphinganine reductase OS=Danio rerio OX=7955 GN=fvt1 PE=1 SV=1
3	AFDB:F4JZN6	0.891	0.893	7.042E-32	331	0.343	0.344	F4JZN6.pdb.gz	TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana OX=3702 GN=TSC10B PE=1 SV=1
4	AFDB:Q556J2	0.858	0.854	8.920E-32	334	0.322	0.320	Q556J2.pdb.gz	KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum OX=44689 GN=ksrA-1 PE=3 SV=1
5	AFDB:Q38BJ6	0.895	0.856	1.431E-31	348	0.319	0.305	Q38BJ6.pdb.gz	Q38BJ6_TRYB2 3-dehydrosphinganine reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3240 PE=3 SV=1
6	AFDB:Q0WRJ2	0.881	0.897	3.474E-31	326	0.331	0.337	Q0WRJ2.pdb.gz	TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana OX=3702 GN=TSC10A PE=1 SV=1
7	AFDB:Q4WSZ0	0.861	0.782	6.733E-27	367	0.262	0.237	Q4WSZ0.pdb.gz	Q4WSZ0_ASPFU 3-dehydrosphinganine reductase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G11150 PE=4 SV=2
8	AFDB:Q55CK8	0.699	0.740	2.088E-23	313	0.226	0.240	Q55CK8.pdb.gz	Q55CK8_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270018 PE=3 SV=1
9	AFDB:Q6IAN0	0.674	0.687	1.860E-22	325	0.235	0.240	Q6IAN0.pdb.gz	DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens OX=9606 GN=DHRS7B PE=1 SV=2
10	AFDB:P38342	0.802	0.830	5.719E-22	320	0.217	0.225	P38342.pdb.gz	TSC10_YEAST 3-ketodihydrosphingosine reductase TSC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSC10 PE=1 SV=2
11	PDB:4ijuB	0.631	0.738	4.480E-20	282	0.193	0.227	4ijuB.pdb.gz	Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
12	PDB:4k26A	0.651	0.807	6.387E-20	265	0.202	0.253	4k26A.pdb.gz	1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
13	PDB:3ay6B	0.633	0.780	1.649E-18	267	0.181	0.225	3ay6B.pdb.gz	Structure-guided mutagenesis for the improvement of substrate speciﬁcity of Bacillus megaterium glucose 1-dehydrogenase IV
14	PDB:6emmA	0.619	0.761	1.649E-18	268	0.172	0.213	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
15	PDB:1nffA	0.607	0.816	1.856E-18	244	0.172	0.234	1nffA.pdb.gz	Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
16	PDB:2zatA	0.616	0.800	2.646E-18	251	0.163	0.215	2zatA.pdb.gz	Molecular basis for peroxisomal localization of tetrameric carbonyl reductase.
17	PDB:2ewmB	0.544	0.725	5.071E-18	247	0.160	0.215	2ewmB.pdb.gz	Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
18	PDB:4is3C	0.614	0.806	6.814E-18	250	0.157	0.208	4is3C.pdb.gz	Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
19	PDB:3a28C	0.610	0.776	7.670E-18	257	0.190	0.245	3a28C.pdb.gz	Structural basis for chiral substrate recognition by two 2,3-butanediol dehydrogenases
20	PDB:1e3wD	0.602	0.773	1.559E-17	255	0.196	0.255	1e3wD.pdb.gz	Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QWW8	0.0	580	359	0.813	0.752	F1QWW8_DANRE 3-dehydrosphinganine reductase OS=Danio rerio OX=7955 GN=fvt1 PE=1 SV=1
2	Q06136	0.0	681	332	1.000	1.000	KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens OX=9606 GN=KDSR PE=1 SV=1
3	Q6GV12	0.0	625	332	0.898	0.898	KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus OX=10090 GN=Kdsr PE=1 SV=1
4	Q0WRJ2	3.25e-57	190	326	0.322	0.328	TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana OX=3702 GN=TSC10A PE=1 SV=1
5	F4JZN6	2.16e-54	182	331	0.352	0.353	TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana OX=3702 GN=TSC10B PE=1 SV=1
6	Q556J2	6.22e-51	174	334	0.322	0.320	KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum OX=44689 GN=ksrA-1 PE=3 SV=1
7	Q38BJ6	6.35e-35	132	348	0.331	0.316	Q38BJ6_TRYB2 3-dehydrosphinganine reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3240 PE=3 SV=1
8	P95101	2.25e-22	97.1	287	0.208	0.240	P95101_MYCTO Oxidoreductase, short-chain dehydrogenase/reductase family OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3143 PE=3 SV=1
9	O53398	2.95e-22	97.1	301	0.184	0.203	O53398_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1050 PE=1 SV=3
10	Q4WSZ0	2.00e-21	95.5	367	0.262	0.237	Q4WSZ0_ASPFU 3-dehydrosphinganine reductase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G11150 PE=4 SV=2
11	Q99J47	8.37e-21	93.2	323	0.187	0.192	DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus OX=10090 GN=Dhrs7b PE=1 SV=1
12	O74628	2.31e-20	91.7	292	0.178	0.202	YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC162.03 PE=3 SV=1
13	O50417	2.37e-20	94.0	650	0.220	0.112	O50417_MYCTU Possible multi-functional enzyme with acyl-CoA-reductase activity AcrA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acrA1 PE=1 SV=1
14	Q9Y394	4.59e-20	91.7	339	0.220	0.215	DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens OX=9606 GN=DHRS7 PE=1 SV=1
15	Q8A945	6.34e-20	89.7	269	0.205	0.253	KDSR_BACTN 3-ketodihydrosphingosine reductase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=kdsr PE=1 SV=1
16	Q6IAN0	6.64e-20	90.9	325	0.190	0.194	DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens OX=9606 GN=DHRS7B PE=1 SV=2
17	Q92EU6	6.04e-19	87.0	254	0.181	0.236	GOLD_LISIN NAD-dependent glycerol dehydrogenase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=golD PE=1 SV=1
18	Q55CK8	1.20e-18	87.0	313	0.214	0.227	Q55CK8_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270018 PE=3 SV=1
19	D3Z6W3	1.78e-18	86.7	317	0.175	0.183	D3Z6W3_MOUSE Retinol dehydrogenase OS=Mus musculus OX=10090 GN=Rdh8 PE=3 SV=1
20	Q8LKV5	3.00e-18	86.7	362	0.238	0.218	HSDB_SESIN 11-beta-hydroxysteroid dehydrogenase B OS=Sesamum indicum OX=4182 GN=SOP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	2.1e-55	198.7	short chain dehydrogenase
2	PF13561 adh_short_C2	1.7e-26	104.8	Enoyl-(Acyl carrier protein) reductase
3	PF00107 ADH_zinc_N	4.6e+02	12.2	Zinc-binding dehydrogenase
4	PF02558 ApbA	3.5e+02	12.2	Ketopantoate reductase PanE/ApbA
5	PF03668 ATP_bind_2	2.8e+02	12.2	P-loop ATPase protein family
6	PF08659 KR	2.5e-10	52.1	KR domain
7	PF13460 NAD_binding_10	7.3	17.9	NAD(P)H-binding
8	PF02719 Polysacc_synt_2	13	16.5	Polysaccharide biosynthesis protein
9	PF02882 THF_DHG_CYH_C	1.9e+02	12.8	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385083

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262554	0.984	Serine palmitoyltransferase 1
2	9606.ENSP00000216484	0.979	Serine palmitoyltransferase 2
3	9606.ENSP00000376453	0.970	Ceramide synthase 6
4	9606.ENSP00000381968	0.969	Serine palmitoyltransferase 3
5	9606.ENSP00000271688	0.966	Ceramide synthase 2
6	9606.ENSP00000316476	0.965	Sphingolipid delta(4)-desaturase DES1
7	9606.ENSP00000251363	0.963	Ceramide synthase 4
8	9606.ENSP00000284382	0.963	Ceramide synthase 3
9	9606.ENSP00000325485	0.963	Ceramide synthase 5
10	9606.ENSP00000307126	0.962	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
11	9606.ENSP00000371152	0.962	Acid ceramidase
12	9606.ENSP00000298130	0.958	Serine palmitoyltransferase small subunit A
13	9606.ENSP00000378897	0.956	Neutral ceramidase
14	9606.ENSP00000434480	0.953	Alkaline ceramidase 3
15	9606.ENSP00000245222	0.949	Sphingosine kinase 2
16	9606.ENSP00000485582	0.949	annotation not available
17	9606.ENSP00000313681	0.945	Sphingosine kinase 1
18	9606.ENSP00000247225	0.933	Sphingosine-1-phosphate phosphatase 1
19	9606.ENSP00000315137	0.931	Sphingosine-1-phosphate phosphatase 2
20	9606.ENSP00000360296	0.911	Phospholipid phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044249	0.998	cellular biosynthetic process
GO:1901566	0.998	organonitrogen compound biosynthetic process
GO:0008610	0.998	lipid biosynthetic process
GO:0006643	0.995	membrane lipid metabolic process
GO:0030148	0.989	sphingolipid biosynthetic process
GO:0050789	0.399	regulation of biological process
GO:0043603	0.379	amide metabolic process
GO:0044281	0.368	small molecule metabolic process
GO:0050794	0.367	regulation of cellular process
GO:0034641	0.359	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0005576	0.614	extracellular region
GO:0005615	0.381	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.

[back to server]