StarFunc result for job id Q06187

User Input

>input (659 residues)
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K134	0.679	0.676	0.000	662	0.939	0.935	A0A0G2K134.pdb.gz	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	AFDB:Q8JH64	0.669	0.670	0.000	657	0.856	0.858	Q8JH64.pdb.gz	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
3	AFDB:F8W3B7	0.603	0.620	3.986E-89	640	0.634	0.653	F8W3B7.pdb.gz	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
4	AFDB:A0A0G2K6M9	0.604	0.720	2.657E-81	550	0.798	0.956	A0A0G2K6M9.pdb.gz	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
5	AFDB:A0A0G2KA94	0.649	0.635	8.339E-78	674	0.537	0.525	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	AFDB:Q5JY90	0.305	0.392	4.382E-73	483	0.731	0.998	Q5JY90.pdb.gz	Q5JY90_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
7	AFDB:Q03526	0.661	0.694	5.559E-70	625	0.490	0.517	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
8	AFDB:P51813	0.417	0.407	1.464E-68	675	0.504	0.492	P51813.pdb.gz	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
9	AFDB:P08630	0.617	0.522	2.186E-64	786	0.442	0.370	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
10	AFDB:P42682	0.655	0.815	1.223E-58	527	0.405	0.507	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
11	PDB:2h8hA	0.568	0.810	2.570E-41	445	0.256	0.380	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.388	0.569	2.437E-33	441	0.249	0.372	1k9aB.pdb.gz
13	PDB:4fl2A	0.384	0.453	8.444E-26	555	0.187	0.222	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.394	0.468	2.555E-25	551	0.182	0.218	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.316	0.684	4.833E-14	283	0.106	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.342	0.789	1.788E-13	269	0.085	0.208	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:5ufuA	0.318	0.547	2.079E-13	369	0.094	0.168	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:3eqdA	0.349	0.692	2.543E-13	315	0.105	0.219	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:1unlA	0.324	0.698	3.110E-13	292	0.073	0.164	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4zhxA	0.321	0.502	3.110E-13	409	0.094	0.152	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K134	1283	637	0.947	0.980	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	A0A0G2K6M9	1356	661	0.985	0.982	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
3	A0A0G2KA94	705	674	0.531	0.519	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	A0A8I5ZXG2	671	607	0.513	0.557	A0A8I5ZXG2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	A0A8I6A3K6	692	681	0.520	0.504	A0A8I6A3K6_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	A0A8I6AJ90	713	485	0.520	0.707	A0A8I6AJ90_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=1
7	A0A8I6GBZ8	654	602	0.505	0.553	A0A8I6GBZ8_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
8	B2RYC7	706	629	0.531	0.556	B2RYC7_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
9	F8W3B7	871	640	0.627	0.645	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
10	P24604	700	630	0.528	0.552	TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus OX=10090 GN=Tec PE=1 SV=2
11	P35991	1363	659	0.983	0.983	BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4
12	P42680	712	631	0.533	0.556	TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2
13	P42681	570	527	0.382	0.478	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
14	P42682	560	527	0.379	0.474	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
15	P51813	652	675	0.511	0.499	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
16	Q03526	641	625	0.492	0.518	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
17	Q06187	1377	659	1.000	1.000	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
18	Q08881	655	620	0.496	0.527	ITK_HUMAN Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1
19	Q5JY90	725	483	0.527	0.718	Q5JY90_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
20	Q5S255	1354	660	0.983	0.982	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	38	14.9	ABC1 atypical kinase-like domain
2	PF01636 APH	93	14.3	Phosphotransferase enzyme family
3	PF00779 BTK	1.7e-09	48.6	BTK motif
4	PF09115 DNApol3-delta_C	8.7e+02	11.8	DNA polymerase III, delta subunit, C terminal
5	PF12330 Haspin_kinase	1.1e+02	13.2	Haspin like kinase domain
6	PF06293 Kdo	55	14.6	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	0.19	22.6	Kinase-like
8	PF00169 PH	7.7e-10	50.6	PH domain
9	PF00069 Pkinase	1.5e-43	160.7	Protein kinase domain
10	PF17667 Pkinase_fungal	54	14.0	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	4.6e-91	316.3	Protein tyrosine and serine/threonine kinase
12	PF00017 SH2	3.6e-18	76.8	SH2 domain
13	PF00018 SH3_1	3.1e-13	60.4	SH3 domain
14	PF17902 SH3_10	17	16.8	SH3 domain
15	PF07653 SH3_2	0.02	26.0	Variant SH3 domain
16	PF08239 SH3_3	0.93	21.3	Bacterial SH3 domain
17	PF06347 SH3_4	3.4e+02	12.4	Bacterial SH3 domain
18	PF14604 SH3_9	0.00011	33.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009167

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012984	0.936	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
2	61853.ENSNLEP00000009578	0.933	Wiskott-Aldrich syndrome
3	61853.ENSNLEP00000002009	0.931	SH3-domain binding protein 5 (BTK-associated)
4	61853.ENSNLEP00000006246	0.910	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
5	61853.ENSNLEP00000009017	0.886	Cbl proto-oncogene, E3 ubiquitin protein ligase
6	61853.ENSNLEP00000010652	0.885	Uncharacterized protein
7	61853.ENSNLEP00000010670	0.885	General transcription factor IIi
8	61853.ENSNLEP00000015244	0.884	Inhibitor of Bruton agammaglobulinemia tyrosine kinase
9	61853.ENSNLEP00000016398	0.858	CD79a molecule, immunoglobulin-associated alpha
10	61853.ENSNLEP00000018381	0.852	CD79b molecule, immunoglobulin-associated beta
11	61853.ENSNLEP00000023274	0.838	Uncharacterized protein
12	61853.ENSNLEP00000006463	0.816	Myeloid differentiation primary response protein MyD88
13	61853.ENSNLEP00000021108	0.786	Tec protein tyrosine kinase
14	61853.ENSNLEP00000000530	0.781	Spleen tyrosine kinase
15	61853.ENSNLEP00000001019	0.777	Growth factor receptor-bound protein 2
16	61853.ENSNLEP00000007631	0.775	Tyrosine-protein kinase
17	61853.ENSNLEP00000015723	0.775	FYN proto-oncogene, Src family tyrosine kinase
18	61853.ENSNLEP00000007890	0.774	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
19	61853.ENSNLEP00000021096	0.771	TXK tyrosine kinase
20	61853.ENSNLEP00000008358	0.770	Tyrosine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.995	cellular process
GO:0051239	0.995	regulation of multicellular organismal process
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.994	signaling
GO:0007154	0.994	cell communication
GO:0044237	0.991	cellular metabolic process
GO:0048856	0.990	anatomical structure development
GO:0018212	0.990	peptidyl-tyrosine modification
GO:0070664	0.989	negative regulation of leukocyte proliferation
GO:0002712	0.989	regulation of B cell mediated immunity
GO:0030888	0.988	regulation of B cell proliferation
GO:0050871	0.988	positive regulation of B cell activation
GO:0051716	0.987	cellular response to stimulus
GO:0002443	0.987	leukocyte mediated immunity
GO:0050778	0.987	positive regulation of immune response
GO:0051179	0.985	localization
GO:0001775	0.985	cell activation
GO:0031347	0.985	regulation of defense response
GO:0002700	0.985	regulation of production of molecular mediator of immune response
GO:0051250	0.985	negative regulation of lymphocyte activation
GO:0045321	0.982	leukocyte activation
GO:0001817	0.982	regulation of cytokine production
GO:0018108	0.982	peptidyl-tyrosine phosphorylation
GO:0002444	0.979	myeloid leukocyte mediated immunity
GO:0001776	0.977	leukocyte homeostasis
GO:0070665	0.975	positive regulation of leukocyte proliferation
GO:0050671	0.974	positive regulation of lymphocyte proliferation
GO:0001780	0.973	neutrophil homeostasis
GO:0045055	0.973	regulated exocytosis
GO:0042221	0.972	response to chemical
GO:0002705	0.971	positive regulation of leukocyte mediated immunity
GO:0002824	0.971	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0065008	0.968	regulation of biological quality
GO:1990849	0.967	vacuolar localization
GO:0032675	0.967	regulation of interleukin-6 production
GO:0001819	0.966	positive regulation of cytokine production
GO:0002274	0.964	myeloid leukocyte activation
GO:0031349	0.962	positive regulation of defense response
GO:0002708	0.962	positive regulation of lymphocyte mediated immunity
GO:0032101	0.960	regulation of response to external stimulus
GO:0006955	0.957	immune response
GO:0010033	0.956	response to organic substance
GO:0002861	0.954	regulation of inflammatory response to antigenic stimulus
GO:0032103	0.952	positive regulation of response to external stimulus
GO:0006950	0.949	response to stress
GO:0002764	0.947	immune response-regulating signaling pathway
GO:0002768	0.944	immune response-regulating cell surface receptor signaling pathway
GO:0023051	0.943	regulation of signaling
GO:0010646	0.943	regulation of cell communication
GO:0046777	0.941	protein autophosphorylation
GO:0009605	0.935	response to external stimulus
GO:0044419	0.920	biological process involved in interspecies interaction between organisms
GO:0009607	0.913	response to biotic stimulus
GO:0001818	0.911	negative regulation of cytokine production
GO:0043207	0.894	response to external biotic stimulus
GO:0006952	0.893	defense response
GO:0031323	0.881	regulation of cellular metabolic process
GO:0051171	0.869	regulation of nitrogen compound metabolic process
GO:0051707	0.862	response to other organism
GO:0051641	0.852	cellular localization
GO:0023061	0.840	signal release
GO:0080090	0.827	regulation of primary metabolic process
GO:0009966	0.822	regulation of signal transduction
GO:0032879	0.818	regulation of localization
GO:0044260	0.791	cellular macromolecule metabolic process
GO:0051049	0.790	regulation of transport
GO:0065009	0.777	regulation of molecular function
GO:0071216	0.762	cellular response to biotic stimulus
GO:0035556	0.761	intracellular signal transduction
GO:1901700	0.745	response to oxygen-containing compound
GO:0070887	0.744	cellular response to chemical stimulus
GO:0050766	0.715	positive regulation of phagocytosis
GO:1901701	0.693	cellular response to oxygen-containing compound
GO:0007275	0.657	multicellular organism development
GO:0033554	0.573	cellular response to stress
GO:0048731	0.556	system development
GO:0010467	0.521	gene expression
GO:0030154	0.513	cell differentiation
GO:0071310	0.491	cellular response to organic substance
GO:0044093	0.474	positive regulation of molecular function
GO:0050793	0.458	regulation of developmental process
GO:0062197	0.450	cellular response to chemical stress
GO:0051173	0.437	positive regulation of nitrogen compound metabolic process
GO:0050790	0.436	regulation of catalytic activity
GO:0009056	0.429	catabolic process
GO:0010941	0.408	regulation of cell death
GO:0031325	0.397	positive regulation of cellular metabolic process
GO:0043067	0.388	regulation of programmed cell death
GO:0071840	0.378	cellular component organization or biogenesis
GO:0010647	0.376	positive regulation of cell communication
GO:0023056	0.375	positive regulation of signaling
GO:1902531	0.369	regulation of intracellular signal transduction
GO:0009967	0.366	positive regulation of signal transduction
GO:0043085	0.362	positive regulation of catalytic activity
GO:0016043	0.355	cellular component organization
GO:0042981	0.346	regulation of apoptotic process
GO:0031326	0.341	regulation of cellular biosynthetic process
GO:0010556	0.332	regulation of macromolecule biosynthetic process
GO:0019219	0.329	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.314	regulation of protein metabolic process
GO:0006355	0.308	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.971	plasma membrane
GO:0043226	0.807	organelle
GO:0043229	0.795	intracellular organelle
GO:0043227	0.752	membrane-bounded organelle
GO:0043231	0.575	intracellular membrane-bounded organelle
GO:0005634	0.386	nucleus
GO:0048471	0.334	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]