StarFunc result for job id Q06190

User Input

>input (1150 residues)
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPV
SQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFA
SGKIKEFSFEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSS
SVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQTIELQNDKPNS
RKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEE
SDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNL
PKEDCKSKVSKFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFL
NSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
FAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQT
PEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPD
TCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTA
QSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE
FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
YVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYAD
FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHD
LLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDG
PEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEK
CGKLQSVDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06190	1.000	1.000	0.000	1150	1.000	1.000	Q06190.pdb.gz	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
2	AFDB:A0A803JG39	0.414	0.422	2.366E-76	1129	0.552	0.562	A0A803JG39.pdb.gz	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
3	AFDB:E9QG28	0.393	0.380	5.749E-75	1192	0.553	0.534	E9QG28.pdb.gz	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
4	AFDB:Q9XGR4	0.342	0.710	8.243E-33	538	0.172	0.368	Q9XGR4.pdb.gz	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
5	AFDB:Q8VZQ4	0.344	0.715	9.528E-32	536	0.171	0.368	Q8VZQ4.pdb.gz	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
6	PDB:1v1fA	0.115	0.552	2.383E-4	188	0.023	0.144	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
7	PDB:2ct9B	0.116	0.508	5.966E-4	198	0.036	0.207	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
8	PDB:2zfdA	0.124	0.608	7.106E-4	183	0.023	0.148	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
9	PDB:2becA	0.108	0.540	1.859E-3	181	0.026	0.166	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
10	PDB:1ggzA	0.064	0.381	2.313E-3	144	0.028	0.222	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
11	PDB:2lhiA	0.073	0.299	2.637E-3	176	0.020	0.131	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
12	PDB:1hqvA	0.062	0.298	2.877E-3	178	0.032	0.208	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
13	PDB:5x9aB	0.117	0.559	2.877E-3	198	0.025	0.146	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
14	PDB:1a2xA	0.061	0.369	3.427E-3	158	0.028	0.203	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
15	PDB:2ggmA	0.065	0.366	3.580E-3	149	0.027	0.208	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
16	AFDB:A8DZ29	0.068	0.048	1.046E-2	1919	0.125	0.075	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
17	AFDB:F4IUY8	0.073	0.080	1.692E-2	1006	0.109	0.124	F4IUY8.pdb.gz	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1
18	AFDB:O43432	0.055	0.052	1.768E-2	1585	0.112	0.081	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
19	AFDB:B8PWL7	0.045	0.050	2.737E-2	994	0.130	0.151	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
20	AFDB:Q80XI3	0.062	0.053	2.987E-2	1579	0.116	0.084	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A803JG39	0.0	1169	1129	0.565	0.576	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
2	B0S5Q0	0.0	743	520	0.312	0.690	B0S5Q0_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=1
3	E9QG28	0.0	1169	1192	0.570	0.550	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
4	Q06190	0.0	2394	1150	1.000	1.000	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
5	Q9Y5P8	0.0	611	575	0.234	0.468	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
6	Q9Z176	4.14e-176	528	491	0.211	0.495	P2R3D_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1
7	Q9XGR4	1.07e-111	361	538	0.163	0.349	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
8	Q8VZQ4	6.87e-110	356	536	0.163	0.351	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
9	Q17744	6.78e-99	327	557	0.142	0.293	Q17744_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F43B10.1 PE=1 SV=4
10	Q38DH1	9.17e-59	217	681	0.108	0.182	Q38DH1_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3350 PE=4 SV=1
11	Q969Q6	1.52e-26	116	453	0.065	0.166	P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
12	Q9JK24	1.81e-26	116	453	0.065	0.166	P2R3C_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Mus musculus OX=10090 GN=Ppp2r3c PE=1 SV=2
13	Q9FEE2	5.89e-21	100	480	0.061	0.146	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
14	Q580J5	5.66e-04	46.2	492	0.044	0.104	Q580J5_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.810 PE=4 SV=1
15	Q9Y6T7	0.11	38.9	804	0.041	0.058	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
16	Q01583	0.13	38.9	1211	0.021	0.020	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
17	Q6NS52	0.13	38.9	802	0.037	0.052	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
18	P49621	0.15	38.5	801	0.037	0.052	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
19	M9PC48	0.88	36.6	18095	0.020	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	H3BMI3	0.89	32.7	69	0.013	0.217	H3BMI3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13062 DUF3924	1.1e+02	14.1	Protein of unknown function (DUF3924)
2	PF13475 DUF4116	3e+02	12.6	Domain of unknown function (DUF4116)
3	PF13821 DUF4187	5e+02	11.9	Domain of unknown function (DUF4187)
4	PF00036 EF-hand_1	0.022	25.4	EF hand
5	PF17958 EF-hand_13	3.6e-35	130.9	EF-hand domain
6	PF13202 EF-hand_5	0.3	21.8	EF hand
7	PF13405 EF-hand_6	0.34	21.9	EF-hand domain
8	PF13499 EF-hand_7	2.3e-17	74.5	EF-hand domain pair
9	PF13833 EF-hand_8	27	15.9	EF-hand domain pair
10	PF10591 SPARC_Ca_bdg	6.9e+02	12.0	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264977

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324804	0.993	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	9606.ENSP00000377036	0.982	Serine/threonine-protein phosphatase 2A activator
3	9606.ENSP00000418447	0.976	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
4	9606.ENSP00000325074	0.953	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
5	9606.ENSP00000261461	0.941	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
6	9606.ENSP00000311344	0.939	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
7	9606.ENSP00000268459	0.935	Protein naked cuticle homolog 1
8	9606.ENSP00000412324	0.930	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
9	9606.ENSP00000399970	0.929	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
10	9606.ENSP00000221138	0.922	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
11	9606.ENSP00000417963	0.893	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
12	9606.ENSP00000164133	0.881	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
13	9606.ENSP00000337641	0.876	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
14	9606.ENSP00000478767	0.870	Neurabin-2
15	9606.ENSP00000355533	0.853	Ryanodine receptor 2
16	9606.ENSP00000335083	0.848	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
17	9606.ENSP00000377936	0.848	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
18	9606.ENSP00000341779	0.836	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
19	9606.ENSP00000209728	0.822	Cell division control protein 6 homolog
20	9606.ENSP00000383402	0.816	Serine/threonine-protein phosphatase 4 regulatory subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019888	1.000	protein phosphatase regulator activity
GO:0030674	0.998	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0032501	0.974	multicellular organismal process
GO:0048856	0.947	anatomical structure development
GO:0050896	0.936	response to stimulus
GO:0007275	0.936	multicellular organism development
GO:0051716	0.933	cellular response to stimulus
GO:0007165	0.922	signal transduction
GO:0009653	0.916	anatomical structure morphogenesis
GO:0048869	0.915	cellular developmental process
GO:0048518	0.904	positive regulation of biological process
GO:0019222	0.900	regulation of metabolic process
GO:0009790	0.899	embryo development
GO:0009966	0.895	regulation of signal transduction
GO:0048522	0.886	positive regulation of cellular process
GO:0048523	0.868	negative regulation of cellular process
GO:0048513	0.854	animal organ development
GO:0030154	0.853	cell differentiation
GO:0080090	0.847	regulation of primary metabolic process
GO:0060255	0.843	regulation of macromolecule metabolic process
GO:0051171	0.837	regulation of nitrogen compound metabolic process
GO:0007389	0.819	pattern specification process
GO:0009887	0.803	animal organ morphogenesis
GO:0048731	0.696	system development
GO:0007166	0.691	cell surface receptor signaling pathway
GO:0061061	0.680	muscle structure development
GO:0009893	0.658	positive regulation of metabolic process
GO:0030111	0.640	regulation of Wnt signaling pathway
GO:0051246	0.604	regulation of protein metabolic process
GO:0003002	0.603	regionalization
GO:2000145	0.532	regulation of cell motility
GO:0010604	0.532	positive regulation of macromolecule metabolic process
GO:0051173	0.519	positive regulation of nitrogen compound metabolic process
GO:0009968	0.368	negative regulation of signal transduction
GO:0048646	0.344	anatomical structure formation involved in morphogenesis
GO:0060429	0.342	epithelium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008287	0.997	protein serine/threonine phosphatase complex
GO:0000159	0.988	protein phosphatase type 2A complex
GO:0110165	0.975	cellular anatomical entity
GO:0005737	0.962	cytoplasm
GO:0043226	0.960	organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005829	0.945	cytosol
GO:0005634	0.904	nucleus
GO:0016020	0.902	membrane
GO:0043233	0.845	organelle lumen
GO:0070013	0.839	intracellular organelle lumen
GO:0005654	0.822	nucleoplasm
GO:0071944	0.489	cell periphery
GO:0012505	0.478	endomembrane system
GO:0005886	0.473	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]