StarFunc result for job id Q06203

User Input

>input (517 residues)
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35433	0.972	0.972	1.653E-100	517	0.934	0.934	P35433.pdb.gz	PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1
2	AFDB:P28173	0.963	0.976	4.063E-92	510	0.822	0.833	P28173.pdb.gz	PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus OX=9031 GN=PPAT PE=1 SV=1
3	AFDB:Q27601	0.927	0.878	2.406E-74	546	0.600	0.568	Q27601.pdb.gz	PUR1_DROME Amidophosphoribosyltransferase OS=Drosophila melanogaster OX=7227 GN=Prat PE=1 SV=2
4	AFDB:Q9SI61	0.846	0.774	5.296E-52	566	0.377	0.345	Q9SI61.pdb.gz	ASE1_ARATH Amidophosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASE1 PE=2 SV=1
5	AFDB:Q9STG9	0.842	0.778	2.381E-51	561	0.373	0.344	Q9STG9.pdb.gz	ASE2_ARATH Amidophosphoribosyltransferase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASE2 PE=1 SV=1
6	AFDB:P0AG16	0.786	0.804	1.106E-46	505	0.323	0.331	P0AG16.pdb.gz	PUR1_ECOLI Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=purF PE=1 SV=2
7	AFDB:P41390	0.802	0.779	1.142E-42	533	0.329	0.319	P41390.pdb.gz	PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade4 PE=1 SV=1
8	PDB:1ecfB	0.793	0.819	1.428E-42	500	0.327	0.338	1ecfB.pdb.gz	Crystal structure of glutamine phosphoribosylpyrophosphate amidotransferase from Escherichia coli.
9	AFDB:P04046	0.806	0.816	2.355E-42	510	0.311	0.316	P04046.pdb.gz	PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE4 PE=1 SV=2
10	AFDB:Q6LWM9	0.414	0.362	2.604E-19	599	0.166	0.144	Q6LWM9.pdb.gz	GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=glmS PE=1 SV=2
11	AFDB:P17169	0.406	0.347	5.567E-18	609	0.166	0.141	P17169.pdb.gz	GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) OX=83333 GN=glmS PE=1 SV=4
12	PDB:4amvA	0.411	0.354	9.017E-17	608	0.168	0.143	4amvA.pdb.gz	Glutamine Binding Opens the Ammonia Channel and Activates Glucosamine-6P Synthase
13	PDB:6gq3A	0.338	0.343	1.397E-10	509	0.112	0.114	6gq3A.pdb.gz	High-resolution crystal structure of human asparagine synthetase enables analysis of inhibitor binding and selectivity.
14	PDB:1ct9A	0.320	0.332	3.460E-8	497	0.118	0.123	1ct9A.pdb.gz	Three-dimensional structure of Escherichia coli asparagine synthetase B: a short journey from substrate to product.
15	PDB:4zfkB	0.344	0.699	3.034E-7	231	0.079	0.177	4zfkB.pdb.gz	Structure of the Ergothioneine-Biosynthesis Amidohydrolase EgtC.
16	PDB:1oroA	0.216	0.463	4.719E-4	213	0.052	0.127	1oroA.pdb.gz	A flexible loop at the dimer interface is a part of the active site of the adjacent monomer of Escherichia coli orotate phosphoribosyltransferase.
17	PDB:5knxB	0.158	0.396	1.698E-3	176	0.041	0.119	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
18	PDB:5vn4A	0.187	0.365	1.796E-3	237	0.048	0.105	5vn4A.pdb.gz	Crystal structure of adenine phosphoribosyl transferase from Trypanosoma brucei in complex with AMP, pyrophosphate, and ribose-5-phosphate
19	PDB:2ps1A	0.211	0.436	2.803E-3	224	0.037	0.085	2ps1A.pdb.gz	Ternary complex formation and induced asymmetry in orotate phosphoribosyltransferase.
20	PDB:2dy0A	0.190	0.463	2.964E-3	182	0.054	0.154	2dy0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28173	0.0	891	510	0.826	0.837	PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus OX=9031 GN=PPAT PE=1 SV=1
2	P35433	0.0	986	517	0.934	0.934	PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1
3	Q06203	0.0	1072	517	1.000	1.000	PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1
4	Q27601	0.0	634	546	0.605	0.573	PUR1_DROME Amidophosphoribosyltransferase OS=Drosophila melanogaster OX=7227 GN=Prat PE=1 SV=2
5	Q8CIH9	0.0	981	517	0.930	0.930	PUR1_MOUSE Amidophosphoribosyltransferase OS=Mus musculus OX=10090 GN=Ppat PE=1 SV=1
6	Q9STG9	4.02e-109	337	561	0.385	0.355	ASE2_ARATH Amidophosphoribosyltransferase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASE2 PE=1 SV=1
7	Q9SI61	1.00e-108	337	566	0.389	0.355	ASE1_ARATH Amidophosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASE1 PE=2 SV=1
8	P0AG16	2.35e-87	280	505	0.342	0.350	PUR1_ECOLI Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=purF PE=1 SV=2
9	P41390	1.78e-80	262	533	0.342	0.332	PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade4 PE=1 SV=1
10	P04046	1.87e-70	235	510	0.315	0.320	PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE4 PE=1 SV=2
11	Q6LWM9	2.34e-13	74.7	599	0.110	0.095	GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=glmS PE=1 SV=2
12	P53704	5.89e-12	70.5	713	0.106	0.077	GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GFA1 PE=1 SV=3
13	P9WN49	1.15e-10	66.2	624	0.099	0.082	GLMS_MYCTU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glmS PE=1 SV=1
14	P17169	1.16e-10	66.2	609	0.139	0.118	GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) OX=83333 GN=glmS PE=1 SV=4
15	Q09740	3.47e-10	65.1	696	0.110	0.082	GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.11 PE=3 SV=2
16	Q9LIP9	3.60e-10	65.1	677	0.106	0.081	GFAT1_ARATH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Arabidopsis thaliana OX=3702 GN=GFAT1 PE=2 SV=1
17	P14742	4.99e-10	64.3	717	0.101	0.073	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
18	Q9Z2Z9	7.31e-10	63.9	682	0.091	0.069	GFPT2_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus OX=10090 GN=Gfpt2 PE=1 SV=3
19	Q582H1	7.96e-10	63.9	659	0.106	0.083	Q582H1_TRYB2 glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.470 PE=4 SV=1
20	O94808	1.23e-09	63.2	682	0.108	0.082	GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13230 GATase_4	0.00014	32.4	Glutamine amidotransferases class-II
2	PF13522 GATase_6	4e-12	57.8	Glutamine amidotransferase domain
3	PF13537 GATase_7	1.8e-09	49.0	Glutamine amidotransferase domain
4	PF00156 Pribosyltran	0.005	27.7	Phosphoribosyl transferase domain
5	PF15609 PRTase_2	1.1e+02	13.7	Phosphoribosyl transferase
6	PF14681 UPRTase	3.6e+02	12.0	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371253	0.999	Trifunctional purine biosynthetic protein adenosine-3
2	9606.ENSP00000382595	0.997	Multifunctional protein ADE2
3	9606.ENSP00000313490	0.994	Phosphoribosylformylglycinamidine synthase
4	9606.ENSP00000236959	0.987	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000264705	0.978	CAD protein
6	9606.ENSP00000307900	0.977	Glutamine synthetase
7	9606.ENSP00000361512	0.974	Ribose-phosphate pyrophosphokinase 1
8	9606.ENSP00000381504	0.970	Ribose-phosphate pyrophosphokinase 2
9	9606.ENSP00000485525	0.965	Adenylosuccinate lyase
10	9606.ENSP00000424595	0.960	Ribose-phosphate pyrophosphokinase 3
11	9606.ENSP00000310447	0.941	Glutaminase liver isoform, mitochondrial
12	9606.ENSP00000349860	0.940	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
13	9606.ENSP00000476535	0.940	annotation not available
14	9606.ENSP00000253778	0.938	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
15	9606.ENSP00000317379	0.932	Glutaminase kidney isoform, mitochondrial
16	9606.ENSP00000412698	0.869	MMS19 nucleotide excision repair protein homolog
17	9606.ENSP00000419851	0.858	GMP synthase [glutamine-hydrolyzing]
18	9606.ENSP00000355493	0.851	Adenylosuccinate synthetase isozyme 2
19	9606.ENSP00000232607	0.802	Uridine 5'-monophosphate synthase
20	9606.ENSP00000333019	0.799	Adenylosuccinate synthetase isozyme 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004044	1.000	amidophosphoribosyltransferase activity
GO:0005488	0.985	binding
GO:0005515	0.984	protein binding
GO:0042802	0.924	identical protein binding
GO:0043167	0.422	ion binding
GO:0036094	0.398	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901293	0.990	nucleoside phosphate biosynthetic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0006163	0.977	purine nucleotide metabolic process
GO:0009165	0.977	nucleotide biosynthetic process
GO:0072522	0.965	purine-containing compound biosynthetic process
GO:0006164	0.964	purine nucleotide biosynthetic process
GO:1901135	0.862	carbohydrate derivative metabolic process
GO:0009123	0.667	nucleoside monophosphate metabolic process
GO:0019693	0.530	ribose phosphate metabolic process
GO:0009161	0.511	ribonucleoside monophosphate metabolic process
GO:0009124	0.498	nucleoside monophosphate biosynthetic process
GO:0009126	0.496	purine nucleoside monophosphate metabolic process
GO:0009156	0.486	ribonucleoside monophosphate biosynthetic process
GO:0009167	0.475	purine ribonucleoside monophosphate metabolic process
GO:0009127	0.458	purine nucleoside monophosphate biosynthetic process
GO:0009168	0.450	purine ribonucleoside monophosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0070013	0.524	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14905	1.000	5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine
EC:2.4.2.14	1.000	amidophosphoribosyltransferase.

[back to server]