StarFunc result for job id Q06210

User Input

>input (699 residues)
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRW
GSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVA
AVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRG
RVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELAS
DFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGV
HINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLS
MDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLAL
VDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVD
CLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94808	0.957	0.981	0.000	682	0.771	0.790	O94808.pdb.gz	GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3
2	AFDB:Q06210	1.000	1.000	0.000	699	1.000	1.000	Q06210.pdb.gz	GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3
3	AFDB:Q3S344	0.970	0.994	0.000	682	0.866	0.887	Q3S344.pdb.gz	Q3S344_DANRE glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Danio rerio OX=7955 GN=hmn PE=1 SV=1
4	AFDB:Q9VAW3	0.942	0.964	2.094E-103	683	0.654	0.669	Q9VAW3.pdb.gz	Q9VAW3_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat2 PE=1 SV=1
5	AFDB:Q7PLC7	0.945	0.952	4.968E-103	694	0.628	0.633	Q7PLC7.pdb.gz	Q7PLC7_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat1 PE=1 SV=2
6	AFDB:Q19130	0.943	0.909	6.132E-100	725	0.597	0.575	Q19130.pdb.gz	Q19130_CAEEL glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Caenorhabditis elegans OX=6239 GN=gfat-1 PE=1 SV=1
7	AFDB:P14742	0.940	0.917	8.136E-95	717	0.558	0.544	P14742.pdb.gz	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
8	AFDB:P53704	0.948	0.930	5.339E-94	713	0.558	0.547	P53704.pdb.gz	GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GFA1 PE=1 SV=3
9	AFDB:Q09740	0.934	0.938	1.508E-91	696	0.535	0.537	Q09740.pdb.gz	GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.11 PE=3 SV=2
10	AFDB:Q9LIP9	0.892	0.920	1.294E-84	677	0.495	0.511	Q9LIP9.pdb.gz	GFAT1_ARATH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Arabidopsis thaliana OX=3702 GN=GFAT1 PE=2 SV=1
11	PDB:4amvA	0.816	0.935	3.031E-56	608	0.356	0.410	4amvA.pdb.gz	Glutamine Binding Opens the Ammonia Channel and Activates Glucosamine-6P Synthase
12	PDB:1ecfB	0.310	0.421	7.169E-14	500	0.130	0.182	1ecfB.pdb.gz	Crystal structure of glutamine phosphoribosylpyrophosphate amidotransferase from Escherichia coli.
13	PDB:1ct9A	0.264	0.360	4.008E-9	497	0.093	0.131	1ct9A.pdb.gz	Three-dimensional structure of Escherichia coli asparagine synthetase B: a short journey from substrate to product.
14	PDB:4lc9A	0.355	0.423	7.377E-9	567	0.080	0.099	4lc9A.pdb.gz	Structural basis for regulation of human glucokinase by glucokinase regulatory protein.
15	PDB:4bb9A	0.343	0.394	1.582E-8	596	0.074	0.087	4bb9A.pdb.gz	Crystal Structure of Glucokinase Regulatory Protein.
16	PDB:6gq3A	0.241	0.320	2.258E-8	509	0.097	0.134	6gq3A.pdb.gz	High-resolution crystal structure of human asparagine synthetase enables analysis of inhibitor binding and selectivity.
17	PDB:2cxnA	0.281	0.343	1.076E-6	557	0.059	0.074	2cxnA.pdb.gz	Crystal structures of mouse autocrine motility factor in complex with carbohydrate phosphate inhibitors provide insight into structure-activity relationship of the inhibitors
18	PDB:2wu8A	0.299	0.367	1.616E-6	549	0.073	0.093	2wu8A.pdb.gz
19	PDB:3pr3A	0.305	0.361	1.981E-6	578	0.084	0.102	3pr3A.pdb.gz	Crystal structure of Plasmodium falciparum glucose-6-phosphate isomerase (PF14_0341) in complex with fructose-6-phosphate
20	PDB:1iriA	0.271	0.330	3.836E-6	557	0.059	0.074	1iriA.pdb.gz	Inhibition mechanism of cytokine activity of human autocrine motility factor examined by crystal structure analyses and site-directed mutagenesis studies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94808	0.0	1142	682	0.775	0.795	GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3
2	P14742	0.0	781	717	0.568	0.554	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
3	P47856	0.0	1427	697	0.986	0.989	GFPT1_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Mus musculus OX=10090 GN=Gfpt1 PE=1 SV=3
4	P53704	0.0	756	713	0.561	0.550	GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GFA1 PE=1 SV=3
5	P82808	0.0	1388	681	0.964	0.990	GFPT1_RAT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Rattus norvegicus OX=10116 GN=Gfpt1 PE=1 SV=3
6	Q06210	0.0	1454	699	1.000	1.000	GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3
7	Q09740	0.0	735	696	0.539	0.542	GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.11 PE=3 SV=2
8	Q19130	0.0	853	725	0.599	0.578	Q19130_CAEEL glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Caenorhabditis elegans OX=6239 GN=gfat-1 PE=1 SV=1
9	Q3S344	0.0	1261	682	0.867	0.889	Q3S344_DANRE glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Danio rerio OX=7955 GN=hmn PE=1 SV=1
10	Q582H1	0.0	561	659	0.442	0.469	Q582H1_TRYB2 glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.470 PE=4 SV=1
11	Q7PLC7	0.0	917	694	0.632	0.637	Q7PLC7_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat1 PE=1 SV=2
12	Q9LIP9	0.0	678	677	0.501	0.517	GFAT1_ARATH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Arabidopsis thaliana OX=3702 GN=GFAT1 PE=2 SV=1
13	Q9VAW3	0.0	947	683	0.657	0.672	Q9VAW3_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat2 PE=1 SV=1
14	Q9Z2Z9	0.0	1137	682	0.771	0.790	GFPT2_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus OX=10090 GN=Gfpt2 PE=1 SV=3
15	P9WN49	4.83e-112	353	624	0.342	0.383	GLMS_MYCTU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glmS PE=1 SV=1
16	Q6LWM9	1.40e-95	309	599	0.323	0.377	GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=glmS PE=1 SV=2
17	P17169	2.30e-95	309	609	0.249	0.286	GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) OX=83333 GN=glmS PE=1 SV=4
18	P0AC00	2.15e-13	74.3	340	0.100	0.206	FRLB_ECOLI Fructoselysine 6-phosphate deglycase OS=Escherichia coli (strain K12) OX=83333 GN=frlB PE=1 SV=1
19	Q8CIH9	2.99e-10	65.5	517	0.076	0.103	PUR1_MOUSE Amidophosphoribosyltransferase OS=Mus musculus OX=10090 GN=Ppat PE=1 SV=1
20	P35433	4.95e-09	61.6	517	0.067	0.091	PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19804 DUF6287	1.8e+02	12.9	Domain of unknown function (DUF6287)
2	PF00310 GATase_2	6.6	17.0	Glutamine amidotransferases class-II
3	PF13230 GATase_4	0.062	23.8	Glutamine amidotransferases class-II
4	PF13522 GATase_6	6.9e-14	63.5	Glutamine amidotransferase domain
5	PF13537 GATase_7	6.1e-09	47.3	Glutamine amidotransferase domain
6	PF01380 SIS	3e-67	235.8	SIS domain
7	PF13580 SIS_2	1.1e+02	14.2	SIS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216410	0.986	Glucosamine-phosphate N-acetyltransferase 1
2	9606.ENSP00000264705	0.964	CAD protein
3	9606.ENSP00000405573	0.958	Glucose-6-phosphate isomerase
4	9606.ENSP00000307900	0.952	Glutamine synthetase
5	9606.ENSP00000423674	0.942	Glucosamine-6-phosphate isomerase 1
6	9606.ENSP00000264220	0.940	Amidophosphoribosyltransferase
7	9606.ENSP00000216037	0.938	X-box-binding protein 1
8	9606.ENSP00000290573	0.938	Hexokinase-2
9	9606.ENSP00000317379	0.937	Glutaminase kidney isoform, mitochondrial
10	9606.ENSP00000402103	0.937	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
11	9606.ENSP00000318318	0.936	Mannose-6-phosphate isomerase
12	9606.ENSP00000253778	0.935	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
13	9606.ENSP00000310447	0.933	Glutaminase liver isoform, mitochondrial
14	9606.ENSP00000455561	0.929	Uncharacterized protein
15	9606.ENSP00000346643	0.926	Putative hexokinase HKDC1
16	9606.ENSP00000292432	0.924	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
17	9606.ENSP00000295448	0.911	Glucosamine-6-phosphate deaminase 2
18	9606.ENSP00000425809	0.868	Phosphoacetylglucosamine mutase
19	9606.ENSP00000356903	0.820	UDP-N-acetylhexosamine pyrophosphorylase
20	9606.ENSP00000386597	0.766	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004360	1.000	glutamine-fructose-6-phosphate transaminase (isomerizing) activity
GO:0005488	0.991	binding
GO:0005515	0.982	protein binding
GO:0042802	0.507	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0044281	0.944	small molecule metabolic process
GO:1901135	0.909	carbohydrate derivative metabolic process
GO:0006793	0.892	phosphorus metabolic process
GO:0019637	0.875	organophosphate metabolic process
GO:0009058	0.707	biosynthetic process
GO:1901576	0.702	organic substance biosynthetic process
GO:1901137	0.662	carbohydrate derivative biosynthetic process
GO:0065007	0.584	biological regulation
GO:0006725	0.569	cellular aromatic compound metabolic process
GO:0050789	0.562	regulation of biological process
GO:0034641	0.548	cellular nitrogen compound metabolic process
GO:0006796	0.542	phosphate-containing compound metabolic process
GO:0050794	0.523	regulation of cellular process
GO:0006139	0.515	nucleobase-containing compound metabolic process
GO:1901564	0.499	organonitrogen compound metabolic process
GO:0055086	0.497	nucleobase-containing small molecule metabolic process
GO:0044249	0.451	cellular biosynthetic process
GO:0050896	0.416	response to stimulus
GO:0006040	0.398	amino sugar metabolic process
GO:0044271	0.345	cellular nitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005576	0.980	extracellular region
GO:0043227	0.977	membrane-bounded organelle
GO:0031982	0.949	vesicle
GO:0070062	0.895	extracellular exosome
GO:0043229	0.820	intracellular organelle
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0016020	0.374	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13237	1.000	D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate
EC:2.6.1.16	1.000	glutamine--fructose-6-phosphate transaminase (isomerizing).

[back to server]