StarFunc result for job id Q06278

User Input

>input (1338 residues)
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESALEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESINLSAVG
YFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1fo4A	0.953	0.981	0.000	1299	0.496	0.511	1fo4A.pdb.gz	Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
2	PDB:2ckjA	0.925	0.979	0.000	1264	0.486	0.514	2ckjA.pdb.gz	Human Milk Xanthine Dehydrogenase is Incompletely Converted to the Oxidase Form in the Absence of Proteolysis. A Structural Explanation.
3	PDB:2e1qA	0.961	0.983	0.000	1307	0.496	0.508	2e1qA.pdb.gz	Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate
4	PDB:3ax7A	0.891	0.972	0.000	1225	0.469	0.513	3ax7A.pdb.gz	Protein conformational gating of enzymatic activity in xanthine oxidoreductase
5	PDB:3zyvB	0.934	0.990	0.000	1262	0.596	0.632	3zyvB.pdb.gz	The First Mammalian Aldehyde Oxidase Crystal Structure: Insights Into Substrate Specificity.
6	PDB:7orcB	0.968	0.997	0.000	1299	0.969	0.998	7orcB.pdb.gz	Interrogating the Inhibition Mechanisms of Human Aldehyde Oxidase by X-ray Crystallography and NMR Spectroscopy: The Raloxifene Case.
7	PDB:7px0B	0.849	0.906	0.000	1253	0.283	0.302	7px0B.pdb.gz	Drosophila melanogaster's Aldehyde Oxidase 1: The First Invertebrate AOX structure
8	AFDB:G3X982	0.977	0.979	0.000	1335	0.616	0.617	G3X982.pdb.gz	AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus OX=10090 GN=Aox3 PE=1 SV=1
9	AFDB:M1ZMM0	0.977	0.979	0.000	1336	0.525	0.526	M1ZMM0.pdb.gz	M1ZMM0_DANRE Xanthine dehydrogenase/oxidase OS=Danio rerio OX=7955 GN=aox3 PE=1 SV=1
10	AFDB:O23887	0.877	0.865	0.000	1358	0.306	0.301	O23887.pdb.gz	ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays OX=4577 GN=AO1 PE=1 SV=1
11	AFDB:O54754	0.987	0.991	0.000	1333	0.826	0.829	O54754.pdb.gz	AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus OX=10090 GN=Aox1 PE=1 SV=2
12	AFDB:P10351	0.960	0.963	0.000	1335	0.443	0.444	P10351.pdb.gz	XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ry PE=2 SV=2
13	AFDB:P47989	0.976	0.980	0.000	1333	0.499	0.500	P47989.pdb.gz	XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens OX=9606 GN=XDH PE=1 SV=4
14	AFDB:P47990	0.967	0.953	0.000	1358	0.524	0.516	P47990.pdb.gz	XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus OX=9031 GN=XDH PE=1 SV=1
15	AFDB:P80457	0.978	0.983	0.000	1332	0.501	0.503	P80457.pdb.gz	XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus OX=9913 GN=XDH PE=1 SV=4
16	AFDB:Q00519	0.976	0.978	0.000	1335	0.501	0.503	Q00519.pdb.gz	XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus OX=10090 GN=Xdh PE=1 SV=5
17	AFDB:Q06278	1.000	1.000	0.000	1338	1.000	1.000	Q06278.pdb.gz	AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens OX=9606 GN=AOX1 PE=1 SV=2
18	PDB:5g5gC	0.481	0.859	3.720E-47	731	0.127	0.233	5g5gC.pdb.gz	The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
19	PDB:3hrdA	0.285	0.863	5.948E-33	420	0.088	0.281	3hrdA.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase
20	PDB:3hrdB	0.212	0.812	2.259E-19	330	0.065	0.264	3hrdB.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4JLI5	0.0	958	1353	0.415	0.410	XDH2_ARATH Xanthine dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=XDH2 PE=2 SV=1
2	G3X982	0.0	1664	1335	0.617	0.618	AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus OX=10090 GN=Aox3 PE=1 SV=1
3	M1ZMM0	0.0	1466	1336	0.530	0.531	M1ZMM0_DANRE Xanthine dehydrogenase/oxidase OS=Danio rerio OX=7955 GN=aox3 PE=1 SV=1
4	O54754	0.0	2285	1333	0.825	0.828	AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus OX=10090 GN=Aox1 PE=1 SV=2
5	P10351	0.0	1202	1335	0.447	0.448	XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ry PE=2 SV=2
6	P22985	0.0	1316	1331	0.497	0.500	XDH_RAT Xanthine dehydrogenase/oxidase OS=Rattus norvegicus OX=10116 GN=Xdh PE=1 SV=3
7	P47989	0.0	1326	1333	0.501	0.503	XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens OX=9606 GN=XDH PE=1 SV=4
8	P47990	0.0	1424	1358	0.528	0.521	XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus OX=9031 GN=XDH PE=1 SV=1
9	P80457	0.0	1336	1332	0.501	0.503	XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus OX=9913 GN=XDH PE=1 SV=4
10	Q00519	0.0	1318	1335	0.501	0.502	XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus OX=10090 GN=Xdh PE=1 SV=5
11	Q06278	0.0	2787	1338	1.000	1.000	AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens OX=9606 GN=AOX1 PE=1 SV=2
12	Q12553	0.0	995	1363	0.404	0.397	XDH_EMENI Xanthine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hxA PE=2 SV=2
13	Q8GUQ8	0.0	978	1361	0.416	0.409	XDH1_ARATH Xanthine dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=XDH1 PE=1 SV=1
14	Q9ESH4	0.0	1652	1336	0.614	0.615	Q9ESH4_MOUSE aldehyde oxidase OS=Mus musculus OX=10090 GN=Aox3 PE=2 SV=1
15	Q9Z0U5	0.0	2301	1333	0.827	0.830	AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus OX=10116 GN=Aox1 PE=1 SV=1
16	R4ZGN4	0.0	909	1405	0.410	0.390	XDH_BLAAD Xanthine dehydrogenase OS=Blastobotrys adeninivorans OX=409370 GN=AXOR PE=1 SV=1
17	Q7G192	9.91e-180	570	1321	0.307	0.311	ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO2 PE=1 SV=2
18	Q7G191	2.11e-178	567	1337	0.315	0.315	ALDO4_ARATH Aldehyde oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=AAO4 PE=1 SV=2
19	Q7G193	1.22e-173	555	1368	0.317	0.310	ALDO1_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO1 PE=1 SV=2
20	O23887	8.49e-166	534	1358	0.315	0.310	ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays OX=4577 GN=AO1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01315 Ald_Xan_dh_C	1.4e-29	114.0	Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain
2	PF03450 CO_deh_flav_C	6.7e-26	101.8	CO dehydrogenase flavoprotein C-terminal domain
3	PF00941 FAD_binding_5	2e-40	149.8	FAD binding domain in molybdopterin dehydrogenase
4	PF00111 Fer2	3.8e-05	34.9	2Fe-2S iron-sulfur cluster binding domain
5	PF01799 Fer2_2	1.7e-26	103.4	[2Fe-2S] binding domain
6	PF02738 MoCoBD_1	1.5e-83	291.3	Molybdopterin cofactor-binding domain
7	PF20256 MoCoBD_2	2.3e-80	281.8	Molybdopterin cofactor-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441434	0.954	Nicotinamide N-methyltransferase
2	9606.ENSP00000301141	0.951	Cytochrome P450 2A6
3	9606.ENSP00000337915	0.947	Cytochrome P450 3A4
4	9606.ENSP00000209668	0.940	Alcohol dehydrogenase 1A, alpha polypeptide
5	9606.ENSP00000296412	0.940	Alcohol dehydrogenase class-3
6	9606.ENSP00000306606	0.939	Alcohol dehydrogenase 1B, beta polypeptide
7	9606.ENSP00000261326	0.937	Molybdenum cofactor sulfurase
8	9606.ENSP00000260682	0.935	Cytochrome P450 2C9
9	9606.ENSP00000324648	0.935	Cytochrome P450 2B6
10	9606.ENSP00000342007	0.935	Cytochrome P450 1A2
11	9606.ENSP00000340684	0.934	Amine oxidase [flavin-containing] A
12	9606.ENSP00000265512	0.931	Alcohol dehydrogenase 4, pi polypeptide
13	9606.ENSP00000360317	0.931	Cytochrome P450 2C8
14	9606.ENSP00000367309	0.930	Amine oxidase [flavin-containing] B
15	9606.ENSP00000231420	0.929	Alanine--glyoxylate aminotransferase 2, mitochondrial
16	9606.ENSP00000426083	0.927	Alcohol dehydrogenase 1C, gamma polypeptide
17	9606.ENSP00000369050	0.926	Cytochrome P450 1A1
18	9606.ENSP00000378359	0.925	Alcohol dehydrogenase 6
19	9606.ENSP00000451406	0.925	17-beta-hydroxysteroid dehydrogenase type 6
20	9606.ENSP00000370639	0.924	Acetylserotonin O-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016623	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, oxygen as acceptor
GO:0043167	0.998	ion binding
GO:0005515	0.998	protein binding
GO:0042802	0.981	identical protein binding
GO:0046983	0.959	protein dimerization activity
GO:0042803	0.945	protein homodimerization activity
GO:0004031	0.926	aldehyde oxidase activity
GO:0043169	0.910	cation binding
GO:0046872	0.889	metal ion binding
GO:0046914	0.880	transition metal ion binding
GO:0097159	0.832	organic cyclic compound binding
GO:1901363	0.829	heterocyclic compound binding
GO:0036094	0.797	small molecule binding
GO:0043168	0.750	anion binding
GO:0043546	0.732	molybdopterin cofactor binding
GO:0050660	0.706	flavin adenine dinucleotide binding
GO:0051537	0.703	2 iron, 2 sulfur cluster binding
GO:0016725	0.399	oxidoreductase activity, acting on CH or CH2 groups
GO:0016726	0.389	oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
GO:0004854	0.360	xanthine dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.997	metabolic process
GO:0071466	0.995	cellular response to xenobiotic stimulus
GO:0044237	0.994	cellular metabolic process
GO:0006805	0.980	xenobiotic metabolic process
GO:0071704	0.623	organic substance metabolic process
GO:0044238	0.358	primary metabolic process
GO:0044281	0.310	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.951	membrane-bounded organelle
GO:0043229	0.775	intracellular organelle
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0016020	0.384	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.3.-	1.000	With oxygen as acceptor.
RHEA:16829	0.926	an aldehyde + H2O + O2 = a carboxylate + H(+) + H2O2
EC:1.2.3.1	0.926	aldehyde oxidase.
EC:1.17.-.-	0.399	Acting on CH or CH2 groups.
EC:1.17.1.-	0.389	With NAD(+) or NADP(+) as acceptor.
RHEA:16669	0.360	H2O + NAD(+) + xanthine = H(+) + NADH + urate
EC:1.17.1.4	0.360	xanthine dehydrogenase.

[back to server]