StarFunc result for job id Q06323

User Input

>input (249 residues)
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97371	0.954	0.954	6.809E-30	249	0.948	0.948	P97371.pdb.gz	PSME1_MOUSE Proteasome activator complex subunit 1 OS=Mus musculus OX=10090 GN=Psme1 PE=1 SV=2
2	PDB:5mx5L	0.854	0.993	2.042E-25	214	0.831	0.967	5mx5L.pdb.gz
3	AFDB:P97372	0.867	0.902	2.638E-18	239	0.470	0.490	P97372.pdb.gz	PSME2_MOUSE Proteasome activator complex subunit 2 OS=Mus musculus OX=10090 GN=Psme2 PE=1 SV=4
4	PDB:7naod	0.835	0.954	8.501E-17	217	0.454	0.521	7naod.pdb.gz
5	AFDB:A0A024R203	0.817	0.769	2.964E-15	265	0.398	0.374	A0A024R203.pdb.gz
6	AFDB:Q9V3P3	0.820	0.833	2.250E-14	245	0.373	0.380	Q9V3P3.pdb.gz	Q9V3P3_DROME LD45860p OS=Drosophila melanogaster OX=7227 GN=REG PE=1 SV=1
7	PDB:7yqcA	0.776	0.972	2.939E-14	198	0.357	0.449	7yqcA.pdb.gz
8	AFDB:K9J957	0.685	0.735	3.200E-11	231	0.329	0.355	K9J957.pdb.gz	K9J957_HUMAN Proteasome activator subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
9	AFDB:Q967U1	0.696	0.768	1.679E-9	225	0.277	0.307	Q967U1.pdb.gz	PSME_DICDI Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1
10	AFDB:Q38BM8	0.613	0.656	4.878E-5	231	0.169	0.182	Q38BM8.pdb.gz	Q38BM8_TRYB2 Proteasome activator protein PA26 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3660 PE=1 SV=1
11	PDB:3ipmO	0.653	0.735	7.751E-4	219	0.177	0.201	3ipmO.pdb.gz
12	AFDB:E3VNM4	0.146	0.087	3.970E-1	460	0.137	0.074	E3VNM4.pdb.gz	TGA10_ARATH Transcription factor TGA10 OS=Arabidopsis thaliana OX=3702 GN=TGA10 PE=1 SV=1
13	AFDB:Q57Y72	0.278	0.288	4.362E-1	235	0.068	0.072	Q57Y72.pdb.gz	Q57Y72_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.160 PE=4 SV=1
14	AFDB:Q09JY9	0.143	0.036	4.573E-1	1726	0.165	0.024	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
15	PDB:8a3tQ	0.274	0.146	4.946E-1	623	0.165	0.066	8a3tQ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:3szrA	0.183	0.102	5.973E-1	559	0.124	0.055	3szrA.pdb.gz
17	PDB:5gtmB	0.159	0.102	6.261E-1	522	0.092	0.044	5gtmB.pdb.gz
18	PDB:6n8jb	0.238	0.113	6.563E-1	647	0.080	0.031	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
19	PDB:7mitE	0.137	0.035	8.709E-1	1438	0.060	0.010	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
20	PDB:6tqeA	0.193	0.087	1.052	634	0.068	0.027	6tqeA.pdb.gz	A mycobacterial ABC transporter mediates the uptake of hydrophilic compounds.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q06323	0.0	508	249	1.000	1.000	PSME1_HUMAN Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1
2	Q2KJE7	6.27e-179	493	249	0.968	0.968	Q2KJE7_BOVIN Proteasome (Prosome, macropain) activator subunit 1 (PA28 alpha) OS=Bos taurus OX=9913 GN=PSME1 PE=2 SV=1
3	P97371	1.89e-154	431	249	0.948	0.948	PSME1_MOUSE Proteasome activator complex subunit 1 OS=Mus musculus OX=10090 GN=Psme1 PE=1 SV=2
4	P61289	1.75e-65	206	254	0.410	0.402	PSME3_HUMAN Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
5	V9HWJ8	1.75e-65	206	254	0.410	0.402	V9HWJ8_HUMAN Epididymis secretory protein Li 283 OS=Homo sapiens OX=9606 GN=HEL-S-283 PE=2 SV=1
6	P97372	2.60e-64	202	239	0.482	0.502	PSME2_MOUSE Proteasome activator complex subunit 2 OS=Mus musculus OX=10090 GN=Psme2 PE=1 SV=4
7	Q9UL46	3.06e-64	202	239	0.474	0.494	PSME2_HUMAN Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4
8	Q9V3P3	3.53e-54	176	245	0.373	0.380	Q9V3P3_DROME LD45860p OS=Drosophila melanogaster OX=7227 GN=REG PE=1 SV=1
9	K9J957	3.49e-46	155	231	0.357	0.385	K9J957_HUMAN Proteasome activator subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
10	Q967U1	2.20e-26	104	225	0.297	0.329	PSME_DICDI Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1
11	K7ENH2	7.73e-26	101	179	0.257	0.358	K7ENH2_HUMAN Proteasome activator subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
12	Q9U8G2	0.68	33.1	231	0.072	0.078	Q9U8G2_9TRYP Proteasome activator protein PA26 (Fragment) OS=Trypanosoma brucei OX=5691 PE=1 SV=1
13	Q38BM8	0.99	32.7	231	0.072	0.078	Q38BM8_TRYB2 Proteasome activator protein PA26 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3660 PE=1 SV=1
14	Q09573	2.2	32.0	1070	0.076	0.018	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
15	Q86HH3	4.4	31.2	755	0.068	0.023	GRLB_DICDI Metabotropic glutamate receptor-like protein B OS=Dictyostelium discoideum OX=44689 GN=grlB PE=2 SV=2
16	Q55DN5	5.1	30.8	1386	0.124	0.022	Q55DN5_DICDI P-type ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269590 PE=4 SV=2
17	Q9W603	5.1	30.8	1035	0.169	0.041	SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis OX=8355 GN=supt16h PE=1 SV=2
18	Q9HBR0	6.2	30.8	1119	0.052	0.012	S38AA_HUMAN Solute carrier family 38 member 10 OS=Homo sapiens OX=9606 GN=SLC38A10 PE=1 SV=2
19	Q9Y5B9	6.5	30.8	1047	0.169	0.040	SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1
20	F1Q7I7	9.1	30.0	778	0.104	0.033	F1Q7I7_DANRE Metal transporter OS=Danio rerio OX=7955 GN=LOC100150651 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02251 PA28_alpha	3.6e-20	83.1	Proteasome activator pa28 alpha subunit
2	PF02252 PA28_beta	1.8e-53	191.6	Proteasome activator pa28 beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000006462

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000006464	0.997	Proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
2	9601.ENSPPYP00000006612	0.979	Proteasome (prosome, macropain) 26S subunit, ATPase, 6
3	9601.ENSPPYP00000009413	0.951	Proteasome activator complex subunit 3
4	9601.ENSPPYP00000019303	0.944	Proteasome (prosome, macropain) subunit, beta type, 8
5	9601.ENSPPYP00000008443	0.927	Proteasome (prosome, macropain) subunit, beta type, 10
6	9601.ENSPPYP00000019305	0.927	Proteasome (prosome, macropain) subunit, beta type, 9
7	9601.ENSPPYP00000018379	0.926	Belongs to the tumor necrosis factor family.
8	9601.ENSPPYP00000005405	0.925	Interferon gamma
9	9601.ENSPPYP00000008832	0.923	Proteasome (prosome, macropain) subunit, beta type, 6
10	9601.ENSPPYP00000006652	0.916	Proteasome (prosome, macropain) subunit, alpha type, 3
11	9601.ENSPPYP00000007603	0.915	Proteasome (prosome, macropain) subunit, alpha type, 4
12	9601.ENSPPYP00000003979	0.912	Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP- dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no lon [...]
13	9601.ENSPPYP00000009557	0.904	Proteasome (prosome, macropain) subunit, beta type, 3
14	9601.ENSPPYP00000001793	0.899	Proteasome (prosome, macropain) subunit, beta type, 2
15	9601.ENSPPYP00000024301	0.898	Proteasome endopeptidase complex
16	9601.ENSPPYP00000001012	0.889	Proteasome (prosome, macropain) subunit, beta type, 4
17	9601.ENSPPYP00000024692	0.889	Proteasome endopeptidase complex
18	9601.ENSPPYP00000021958	0.872	Proteasome (prosome, macropain) subunit, beta type, 7
19	9601.ENSPPYP00000015370	0.870	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
20	9601.ENSPPYP00000011119	0.866	Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061133	1.000	endopeptidase activator activity
GO:0042802	0.331	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.992	regulation of primary metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0051246	0.960	regulation of protein metabolic process
GO:0048518	0.912	positive regulation of biological process
GO:0051173	0.880	positive regulation of nitrogen compound metabolic process
GO:0010604	0.880	positive regulation of macromolecule metabolic process
GO:0030162	0.826	regulation of proteolysis
GO:0050794	0.788	regulation of cellular process
GO:0065009	0.710	regulation of molecular function
GO:0002376	0.668	immune system process
GO:0019882	0.584	antigen processing and presentation
GO:0048522	0.569	positive regulation of cellular process
GO:0019884	0.532	antigen processing and presentation of exogenous antigen
GO:0031323	0.390	regulation of cellular metabolic process
GO:0031325	0.371	positive regulation of cellular metabolic process
GO:0010468	0.350	regulation of gene expression
GO:0031326	0.346	regulation of cellular biosynthetic process
GO:0009987	0.328	cellular process
GO:0051247	0.314	positive regulation of protein metabolic process
GO:0050790	0.302	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0000502	0.998	proteasome complex
GO:0005576	0.992	extracellular region
GO:0070062	0.982	extracellular exosome
GO:0016020	0.684	membrane
GO:0012505	0.380	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]