StarFunc result for job id Q06330

User Input

>input (500 residues)
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31266	0.969	0.921	1.411E-90	526	0.978	0.930	P31266.pdb.gz	SUH_MOUSE Recombining binding protein suppressor of hairless OS=Mus musculus OX=10090 GN=Rbpj PE=1 SV=1
2	AFDB:Q6YLA3	0.893	0.897	1.113E-81	498	0.884	0.888	Q6YLA3.pdb.gz
3	AFDB:P28159	0.858	0.723	3.394E-74	594	0.720	0.606	P28159.pdb.gz	SUH_DROME Suppressor of hairless protein OS=Drosophila melanogaster OX=7227 GN=Su(H) PE=1 SV=1
4	AFDB:D6RF98	0.578	0.665	1.117E-65	434	0.858	0.988	D6RF98.pdb.gz	D6RF98_HUMAN Recombination signal binding protein for immunoglobulin kappa J region OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=2
5	AFDB:Q9UBG7	0.794	0.769	4.078E-55	517	0.496	0.480	Q9UBG7.pdb.gz	RBPJL_HUMAN Recombining binding protein suppressor of hairless-like protein OS=Homo sapiens OX=9606 GN=RBPJL PE=1 SV=3
6	AFDB:O08674	0.777	0.755	7.665E-55	515	0.496	0.482	O08674.pdb.gz	RBPJL_MOUSE Recombining binding protein suppressor of hairless-like protein OS=Mus musculus OX=10090 GN=Rbpjl PE=1 SV=1
7	AFDB:V6CLJ5	0.781	0.498	9.770E-55	790	0.504	0.319	V6CLJ5.pdb.gz	LAG1_CAEEL Suppressor of hairless protein homolog OS=Caenorhabditis elegans OX=6239 GN=lag-1 PE=1 SV=1
8	AFDB:O74954	0.638	0.530	8.171E-28	613	0.248	0.202	O74954.pdb.gz	CBF11_SCHPO Transcription factor cbf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf11 PE=1 SV=1
9	AFDB:O74412	0.621	0.340	2.140E-22	963	0.190	0.099	O74412.pdb.gz	CBF12_SCHPO Transcription factor cbf12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf12 PE=2 SV=1
10	AFDB:P40578	0.159	0.083	6.561E-6	1113	0.178	0.080	P40578.pdb.gz	MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGA2 PE=1 SV=1
11	PDB:7t3rA	0.195	0.051	8.061E-4	2130	0.098	0.023	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
12	PDB:3v0aB	0.158	0.077	1.132E-3	1150	0.070	0.030	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:7t3pA	0.191	0.051	4.200E-3	2066	0.094	0.023	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	PDB:5y31B	0.090	0.089	7.520E-3	511	0.080	0.078	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
15	PDB:7vonA	0.157	0.064	1.056E-2	1399	0.080	0.029	7vonA.pdb.gz
16	PDB:3lxuX	0.158	0.077	1.109E-2	1217	0.076	0.031	3lxuX.pdb.gz
17	PDB:7rroE	0.217	0.399	1.222E-2	255	0.050	0.098	7rroE.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:5iv5BJ	0.116	0.065	1.635E-2	1004	0.092	0.046	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
19	PDB:5ngjA	0.088	0.097	2.084E-2	440	0.100	0.114	5ngjA.pdb.gz
20	PDB:7ua3A	0.195	0.030	2.084E-2	4443	0.068	0.008	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUF4	0.0	1030	526	0.982	0.933	A0A8I5ZUF4_RAT Recombination signal binding protein for immunoglobulin kappa J region OS=Rattus norvegicus OX=10116 GN=Rbpj PE=3 SV=1
2	A0A8I6AFG7	0.0	1000	485	0.952	0.981	A0A8I6AFG7_RAT Recombination signal binding protein for immunoglobulin kappa J region OS=Rattus norvegicus OX=10116 GN=Rbpj PE=3 SV=1
3	A0A8I6AL64	0.0	1000	486	0.952	0.979	A0A8I6AL64_RAT Recombination signal binding protein for immunoglobulin kappa J region OS=Rattus norvegicus OX=10116 GN=Rbpj PE=3 SV=1
4	A0A8I6AN87	0.0	999	491	0.952	0.969	A0A8I6AN87_RAT Recombination signal binding protein for immunoglobulin kappa J region OS=Rattus norvegicus OX=10116 GN=Rbpj PE=3 SV=1
5	A4FTT4	0.0	917	491	0.870	0.886	A4FTT4_DANRE Recombination signal-binding protein for immunoglobulin kappa J region b OS=Danio rerio OX=7955 GN=Su(H)2 PE=2 SV=1
6	D6RF98	0.0	875	434	0.856	0.986	D6RF98_HUMAN Recombination signal binding protein for immunoglobulin kappa J region OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=2
7	M0R7Q3	0.0	1003	487	0.954	0.979	M0R7Q3_RAT Recombination signal binding protein for immunoglobulin kappa J region OS=Rattus norvegicus OX=10116 GN=Rbpj PE=3 SV=3
8	P28159	0.0	765	594	0.714	0.601	SUH_DROME Suppressor of hairless protein OS=Drosophila melanogaster OX=7227 GN=Su(H) PE=1 SV=1
9	P31266	0.0	1027	526	0.978	0.930	SUH_MOUSE Recombining binding protein suppressor of hairless OS=Mus musculus OX=10090 GN=Rbpj PE=1 SV=1
10	Q06330	0.0	1051	500	1.000	1.000	SUH_HUMAN Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=3
11	Q91880	0.0	981	501	0.938	0.936	SUH_XENLA Suppressor of hairless protein homolog OS=Xenopus laevis OX=8355 GN=rbpj PE=1 SV=1
12	Q9UBG7	1.07e-174	503	517	0.478	0.462	RBPJL_HUMAN Recombining binding protein suppressor of hairless-like protein OS=Homo sapiens OX=9606 GN=RBPJL PE=1 SV=3
13	O08674	1.13e-172	498	515	0.486	0.472	RBPJL_MOUSE Recombining binding protein suppressor of hairless-like protein OS=Mus musculus OX=10090 GN=Rbpjl PE=1 SV=1
14	V6CLJ5	5.91e-164	485	790	0.508	0.322	LAG1_CAEEL Suppressor of hairless protein homolog OS=Caenorhabditis elegans OX=6239 GN=lag-1 PE=1 SV=1
15	D6R946	4.72e-130	376	178	0.356	1.000	D6R946_HUMAN Recombining-binding protein suppressor of hairless (Fragment) OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=1
16	H0Y8R3	1.07e-86	264	135	0.270	1.000	H0Y8R3_HUMAN Recombining-binding protein suppressor of hairless (Fragment) OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=1
17	O74954	5.79e-28	119	613	0.224	0.183	CBF11_SCHPO Transcription factor cbf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf11 PE=1 SV=1
18	O74412	7.95e-18	89.4	963	0.206	0.107	CBF12_SCHPO Transcription factor cbf12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf12 PE=2 SV=1
19	D6RE93	5.87e-08	50.8	28	0.044	0.786	D6RE93_HUMAN Recombining-binding protein suppressor of hairless (Fragment) OS=Homo sapiens OX=9606 GN=RBPJ PE=4 SV=1
20	Q9Y794	0.44	35.8	972	0.068	0.035	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09270 BTD	3.2e-58	206.6	Beta-trefoil DNA-binding domain
2	PF09271 LAG1-DNAbind	4.7e-44	162.1	LAG1, DNA binding
3	PF16179 RHD_dimer	79	14.7	Rel homology dimerisation domain
4	PF01833 TIG	2.7	19.5	IPT/TIG domain
5	PF20144 TIG_SUH	3.1e-29	112.3	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256646	0.999	Neurogenic locus notch homolog protein 2
2	9606.ENSP00000277541	0.999	Neurogenic locus notch homolog protein 1
3	9606.ENSP00000292599	0.999	Mastermind-like protein 1
4	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
5	9606.ENSP00000263388	0.998	Neurogenic locus notch homolog protein 3
6	9606.ENSP00000364912	0.998	Msx2-interacting protein
7	9606.ENSP00000362649	0.997	Histone deacetylase 1
8	9606.ENSP00000377710	0.997	Four and a half LIM domains protein 1
9	9606.ENSP00000268712	0.995	Nuclear receptor corepressor 1
10	9606.ENSP00000261531	0.994	SNW domain-containing protein 1
11	9606.ENSP00000365687	0.992	Pancreas transcription factor 1 subunit alpha
12	9606.ENSP00000379258	0.988	Transcriptional activator GLI3
13	9606.ENSP00000434552	0.985	Mastermind-like protein 2
14	9606.ENSP00000364163	0.984	Neurogenic locus notch homolog protein 4
15	9606.ENSP00000263253	0.983	Histone acetyltransferase p300
16	9606.ENSP00000338272	0.983	Hairy/enhancer-of-split related with YRPW motif protein 1
17	9606.ENSP00000357348	0.981	Hairy/enhancer-of-split related with YRPW motif protein 2
18	9606.ENSP00000232424	0.980	Transcription factor HES-1
19	9606.ENSP00000383042	0.980	Lysine-specific histone demethylase 1A
20	9606.ENSP00000367714	0.978	Transcription factor HES-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0005515	0.999	protein binding
GO:0140110	0.997	transcription regulator activity
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0000977	0.994	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.988	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.980	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.800	chromatin binding
GO:0008134	0.675	transcription factor binding
GO:0140297	0.326	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0009889	0.985	regulation of biosynthetic process
GO:0048522	0.985	positive regulation of cellular process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0006355	0.984	regulation of DNA-templated transcription
GO:0048523	0.979	negative regulation of cellular process
GO:0009987	0.978	cellular process
GO:0042127	0.974	regulation of cell population proliferation
GO:0051173	0.971	positive regulation of nitrogen compound metabolic process
GO:0031325	0.970	positive regulation of cellular metabolic process
GO:0050896	0.949	response to stimulus
GO:0045893	0.939	positive regulation of DNA-templated transcription
GO:0032502	0.929	developmental process
GO:0008284	0.926	positive regulation of cell population proliferation
GO:0048856	0.918	anatomical structure development
GO:0040012	0.868	regulation of locomotion
GO:0032501	0.862	multicellular organismal process
GO:0030334	0.851	regulation of cell migration
GO:0048660	0.842	regulation of smooth muscle cell proliferation
GO:0040013	0.829	negative regulation of locomotion
GO:0007275	0.828	multicellular organism development
GO:0043066	0.819	negative regulation of apoptotic process
GO:0030336	0.812	negative regulation of cell migration
GO:0048513	0.790	animal organ development
GO:0014910	0.768	regulation of smooth muscle cell migration
GO:0048661	0.761	positive regulation of smooth muscle cell proliferation
GO:0051716	0.760	cellular response to stimulus
GO:0010660	0.734	regulation of muscle cell apoptotic process
GO:0010656	0.710	negative regulation of muscle cell apoptotic process
GO:0007154	0.696	cell communication
GO:0048731	0.696	system development
GO:0031345	0.696	negative regulation of cell projection organization
GO:0010977	0.692	negative regulation of neuron projection development
GO:0007165	0.688	signal transduction
GO:0006357	0.606	regulation of transcription by RNA polymerase II
GO:0009892	0.575	negative regulation of metabolic process
GO:0010605	0.557	negative regulation of macromolecule metabolic process
GO:0045944	0.479	positive regulation of transcription by RNA polymerase II
GO:0051172	0.478	negative regulation of nitrogen compound metabolic process
GO:0031324	0.476	negative regulation of cellular metabolic process
GO:0031327	0.470	negative regulation of cellular biosynthetic process
GO:0010558	0.467	negative regulation of macromolecule biosynthetic process
GO:0051253	0.465	negative regulation of RNA metabolic process
GO:0045892	0.455	negative regulation of DNA-templated transcription
GO:0000122	0.421	negative regulation of transcription by RNA polymerase II
GO:0007166	0.415	cell surface receptor signaling pathway
GO:0048583	0.371	regulation of response to stimulus
GO:0072359	0.363	circulatory system development
GO:0030154	0.354	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005634	1.000	nucleus
GO:0031974	0.966	membrane-enclosed lumen
GO:0005654	0.938	nucleoplasm
GO:0005737	0.700	cytoplasm
GO:0032993	0.468	protein-DNA complex
GO:0005667	0.382	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]