StarFunc result for job id Q06413

User Input

>input (473 residues)
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CFN5	0.398	0.397	3.005E-65	474	0.989	0.987	Q8CFN5.pdb.gz	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
2	AFDB:A0A0R4J2G5	0.224	0.243	5.655E-59	433	0.915	1.000	A0A0R4J2G5.pdb.gz	A0A0R4J2G5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
3	AFDB:A0A0R4ITE5	0.356	0.351	1.496E-52	483	0.814	0.797	A0A0R4ITE5.pdb.gz
4	AFDB:Q6NSN7	0.219	0.212	2.022E-50	491	0.780	0.752	Q6NSN7.pdb.gz
5	AFDB:D8L7E9	0.181	0.218	1.273E-49	393	0.831	1.000	D8L7E9.pdb.gz	D8L7E9_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
6	AFDB:A0A068EUV3	0.262	0.294	1.632E-46	411	0.719	0.827	A0A068EUV3.pdb.gz
7	AFDB:A0A068F1F8	0.223	0.254	5.645E-45	414	0.700	0.800	A0A068F1F8.pdb.gz
8	AFDB:A0A0U3JVR0	0.233	0.294	3.519E-40	371	0.641	0.817	A0A0U3JVR0.pdb.gz
9	AFDB:Q02078	0.282	0.266	3.822E-39	507	0.649	0.606	Q02078.pdb.gz	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
10	AFDB:Q1LXH5	0.212	0.206	1.990E-37	488	0.626	0.607	Q1LXH5.pdb.gz
11	PDB:3zqjF	0.059	0.047	5.182E-1	607	0.023	0.018	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
12	PDB:2jkfA	0.050	0.103	9.569E-1	170	0.006	0.018	2jkfA.pdb.gz
13	PDB:3jb9M	0.057	0.121	9.569E-1	207	0.038	0.087	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:5ndgn4	0.045	0.159	9.569E-1	118	0.019	0.076	5ndgn4.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
15	PDB:6bk8E	0.068	0.155	1.024	186	0.034	0.086	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
16	PDB:6ip52Q	0.063	0.135	1.097	124	0.027	0.105	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
17	PDB:5mpsK	0.062	0.140	1.174	187	0.044	0.112	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
18	PDB:7ls2Q2	0.044	0.180	1.174	110	0.025	0.109	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
19	PDB:5datn4	0.065	0.146	1.345	135	0.025	0.089	5datn4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
20	PDB:6v8oO	0.055	0.067	1.345	384	0.044	0.055	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJY4	0.0	963	473	0.996	0.996	MEF2C_RAT Myocyte-specific enhancer factor 2C OS=Rattus norvegicus OX=10116 GN=Mef2c PE=1 SV=1
2	A0A0D9SFD0	0.0	770	431	0.860	0.944	A0A0D9SFD0_HUMAN MADS box transcription enhancer factor 2, polypeptide C (Myocyte enhancer factor 2C), isoform CRA_e OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
3	A0A0D9SGF3	0.0	646	327	0.691	1.000	A0A0D9SGF3_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=4
4	A0A0D9SGI5	0.0	870	471	0.945	0.949	A0A0D9SGI5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
5	A0A0R4J2G5	0.0	865	433	0.915	1.000	A0A0R4J2G5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
6	A0A1B0GV32	0.0	932	462	0.977	1.000	A0A1B0GV32_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
7	A0A2R8QP40	0.0	667	472	0.740	0.742	A0A2R8QP40_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=1
8	A2BGA7	0.0	734	474	0.814	0.812	A2BGA7_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=1
9	B5A8L9	0.0	704	475	0.797	0.794	B5A8L9_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=2 SV=1
10	D6RJG6	0.0	751	399	0.776	0.920	D6RJG6_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
11	D8L7E9	0.0	717	393	0.825	0.992	D8L7E9_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
12	F1QNL1	0.0	704	475	0.797	0.794	F1QNL1_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=3
13	Q06413	0.0	966	473	1.000	1.000	MEF2C_HUMAN Myocyte-specific enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
14	Q6PCS3	0.0	707	465	0.799	0.813	Q6PCS3_DANRE Myocyte enhancer factor 2ca OS=Danio rerio OX=7955 GN=id:ibd5026 PE=2 SV=1
15	Q8CFN5	0.0	954	474	0.989	0.987	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
16	A0A0S2Z4N0	4.90e-167	482	505	0.655	0.614	A0A0S2Z4N0_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
17	A0A0S2Z417	5.28e-166	479	497	0.645	0.614	A0A0S2Z417_HUMAN Myocyte enhancer factor 2A isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
18	Q02078	1.70e-162	471	507	0.643	0.600	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
19	A0A0S2Z454	1.20e-161	468	499	0.632	0.599	A0A0S2Z454_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_b (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
20	Q60929	5.22e-161	466	498	0.645	0.612	MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus OX=10090 GN=Mef2a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01049 CADH_Y-type_LIR	1.8e+02	13.7	Cadherin, Y-type LIR-motif
2	PF12347 HJURP_C	1.2e-14	65.3	Holliday junction regulator protein family C-terminal repeat
3	PF00319 SRF-TF	5.6e-21	85.1	SRF-type transcription factor (DNA-binding and dimerisation domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008837647.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008827347.1	0.973	Histone deacetylase 4 isoform X1
2	1026970.XP_008832961.1	0.972	Mitogen-activated protein kinase 11
3	1026970.XP_008838309.1	0.972	Mitogen-activated protein kinase 14
4	1026970.XP_008832958.1	0.958	Mitogen-activated protein kinase 12 isoform X1
5	1026970.XP_008838307.1	0.958	Mitogen-activated protein kinase 13
6	1026970.XP_008851779.1	0.948	Myocyte-specific enhancer factor 2D isoform X1
7	1026970.XP_008836377.1	0.942	Histone deacetylase 5 isoform X1
8	1026970.XP_008849273.1	0.940	Protein tyrosine kinase 2
9	1026970.XP_008848997.1	0.938	Homeobox protein Nkx-2.5
10	1026970.XP_008847739.1	0.931	Myocyte-specific enhancer factor 2A isoform X1
11	1026970.XP_008830923.1	0.908	Histone deacetylase 9
12	1026970.XP_008826380.1	0.897	Transcription factor GATA-4
13	1026970.XP_008835547.1	0.884	PPARG coactivator 1 alpha
14	1026970.XP_008831611.1	0.879	Myogenic differentiation 1
15	1026970.XP_008836108.1	0.878	Calcineurin-binding protein cabin-1
16	1026970.XP_008848910.1	0.875	Nuclear factor of activated T-cells 1
17	1026970.XP_008845360.1	0.863	Heart- and neural crest derivatives-expressed protein 2
18	1026970.XP_008824699.1	0.862	Mitogen-activated protein kinase 7 isoform X1
19	1026970.XP_008828566.1	0.854	Myogenin
20	1026970.XP_008843037.1	0.854	E1A binding protein p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0005515	0.988	protein binding
GO:0000977	0.864	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.797	transcription regulator activity
GO:0001228	0.771	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.751	enzyme binding
GO:0000978	0.328	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0072359	0.988	circulatory system development
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.968	positive regulation of cellular process
GO:0061061	0.948	muscle structure development
GO:0007507	0.942	heart development
GO:0006355	0.927	regulation of DNA-templated transcription
GO:0030154	0.839	cell differentiation
GO:0006357	0.838	regulation of transcription by RNA polymerase II
GO:1902680	0.836	positive regulation of RNA biosynthetic process
GO:1903508	0.829	positive regulation of nucleic acid-templated transcription
GO:0045893	0.822	positive regulation of DNA-templated transcription
GO:0045944	0.771	positive regulation of transcription by RNA polymerase II
GO:0071840	0.740	cellular component organization or biogenesis
GO:0016043	0.717	cellular component organization
GO:0008152	0.675	metabolic process
GO:0042692	0.628	muscle cell differentiation
GO:0009888	0.609	tissue development
GO:0022607	0.586	cellular component assembly
GO:0009887	0.563	animal organ morphogenesis
GO:0048468	0.502	cell development
GO:0044237	0.495	cellular metabolic process
GO:0051146	0.481	striated muscle cell differentiation
GO:0048646	0.411	anatomical structure formation involved in morphogenesis
GO:0055001	0.360	muscle cell development
GO:0003012	0.341	muscle system process
GO:0003007	0.319	heart morphogenesis
GO:0044093	0.300	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.978	nucleoplasm
GO:0005737	0.826	cytoplasm
GO:0005886	0.503	plasma membrane
GO:0012505	0.493	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]