StarFunc result for job id Q06416

User Input

>input (359 residues)
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPG
AVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFS
QKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENR
VRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAA
GSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D2IYK3	0.497	0.496	4.880E-42	360	0.961	0.958	D2IYK3.pdb.gz	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
2	AFDB:P20263	0.519	0.528	5.952E-37	352	0.813	0.830	P20263.pdb.gz	PO5F1_MOUSE POU domain, class 5, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou5f1 PE=1 SV=1
3	AFDB:B7ZQA9	0.417	0.339	1.756E-18	445	0.421	0.339	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
4	AFDB:A7Y7W2	0.376	0.348	4.639E-18	389	0.418	0.386	A7Y7W2.pdb.gz	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
5	AFDB:Q9DAC9	0.230	0.247	3.417E-17	329	0.460	0.502	Q9DAC9.pdb.gz	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
6	AFDB:P20267	0.373	0.299	1.957E-15	451	0.390	0.310	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
7	AFDB:Q2VUE0	0.377	0.512	1.294E-14	260	0.334	0.462	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
8	AFDB:H0YNW1	0.370	0.316	4.560E-13	424	0.345	0.292	H0YNW1.pdb.gz	H0YNW1_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
9	AFDB:P25425	0.378	0.179	7.022E-13	770	0.329	0.153	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
10	AFDB:F1Q813	0.231	0.226	1.994E-11	368	0.267	0.261	F1Q813.pdb.gz
11	PDB:6t90K	0.199	0.960	3.350E-8	73	0.195	0.959	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.137	0.097	2.851E-2	539	0.086	0.058	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:2hi3A	0.141	0.604	8.545E-1	73	0.042	0.205	2hi3A.pdb.gz
14	PDB:3gn5A	0.150	0.310	1.547	132	0.050	0.136	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
15	PDB:7fbyA	0.107	0.227	1.633	153	0.025	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:5iplF	0.107	0.124	1.724	277	0.067	0.087	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
17	PDB:2w96A	0.122	0.142	2.257	249	0.058	0.084	2w96A.pdb.gz
18	PDB:3dnvB	0.126	0.496	2.257	71	0.045	0.225	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
19	PDB:2cg4A	0.114	0.256	2.654	149	0.028	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:1g3nC	0.110	0.142	2.801	233	0.067	0.103	1g3nC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D2IYK3	0.0	626	360	0.961	0.958	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
2	P20263	0.0	547	352	0.805	0.821	PO5F1_MOUSE POU domain, class 5, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou5f1 PE=1 SV=1
3	Q01860	0.0	626	360	0.961	0.958	PO5F1_HUMAN POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1
4	Q06416	0.0	725	359	1.000	1.000	P5F1B_HUMAN Putative POU domain, class 5, transcription factor 1B OS=Homo sapiens OX=9606 GN=POU5F1B PE=5 SV=2
5	Q6MG27	0.0	548	352	0.811	0.827	Q6MG27_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou5f1 PE=2 SV=1
6	E2JL35	2.39e-82	250	179	0.404	0.810	E2JL35_MOUSE Octamer-binding transcription factor 3 (Fragment) OS=Mus musculus OX=10090 GN=Pou5f1 PE=2 SV=1
7	Q9DAC9	1.11e-78	246	329	0.465	0.508	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
8	Q8N7G0	3.76e-72	229	328	0.409	0.448	PO5F2_HUMAN POU domain, class 5, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU5F2 PE=1 SV=1
9	B7ZQA9	1.69e-66	218	445	0.306	0.247	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
10	A7Y7W2	1.88e-65	214	389	0.329	0.303	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
11	Q7T103	2.47e-63	210	449	0.301	0.241	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1
12	Q90270	1.55e-61	206	472	0.279	0.212	PO5F1_DANRE POU domain, class 5, transcription factor 1 OS=Danio rerio OX=7955 GN=pou5f1 PE=2 SV=1
13	Q2VUE0	2.74e-56	186	260	0.267	0.369	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
14	P62515	4.14e-56	189	361	0.259	0.258	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
15	P62516	4.14e-56	189	361	0.259	0.258	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
16	A0A2R8Y739	5.28e-56	188	361	0.259	0.258	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
17	O73861	7.23e-56	188	372	0.270	0.261	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
18	P79746	1.04e-55	188	378	0.267	0.254	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
19	Q91989	1.04e-55	189	426	0.298	0.251	P5F13_XENLA POU domain, class 5, transcription factor 1.3 OS=Xenopus laevis OX=8355 GN=pou5f1.3 PE=1 SV=1
20	P20265	1.19e-55	190	443	0.259	0.210	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	2.3e-12	57.9	Homeodomain
2	PF00157 Pou	2.5e-30	115.6	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229307	0.986	Homeobox protein NANOG
2	9606.ENSP00000323588	0.982	Transcription factor SOX-2
3	9606.ENSP00000351446	0.868	WD repeat-containing protein 5
4	9606.ENSP00000217086	0.839	Sal-like protein 4
5	9606.ENSP00000422488	0.821	Steroid hormone receptor ERR2
6	9606.ENSP00000259915	0.806	POU domain, class 5, transcription factor 1
7	9606.ENSP00000362649	0.750	Histone deacetylase 1
8	9606.ENSP00000349508	0.740	Chromodomain-helicase-DNA-binding protein 4
9	9606.ENSP00000344456	0.738	Catenin beta-1
10	9606.ENSP00000395654	0.738	Transcription activator BRG1
11	9606.ENSP00000343126	0.723	AT-rich interactive domain-containing protein 3B
12	9606.ENSP00000362824	0.715	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
13	9606.ENSP00000278823	0.713	Metastasis-associated protein MTA2
14	9606.ENSP00000357644	0.713	Transcriptional repressor p66-beta
15	9606.ENSP00000320171	0.675	Pyruvate kinase PKM
16	9606.ENSP00000302578	0.666	Protein FAM84B
17	9606.ENSP00000297316	0.661	Transcription factor SOX-17
18	9606.ENSP00000430432	0.660	Histone deacetylase 2
19	9606.ENSP00000383042	0.649	Lysine-specific histone demethylase 1A
20	9606.ENSP00000292431	0.647	Nucleus accumbens-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0043565	0.998	sequence-specific DNA binding
GO:0003690	0.997	double-stranded DNA binding
GO:1990837	0.993	sequence-specific double-stranded DNA binding
GO:0000981	0.988	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.957	transcription cis-regulatory region binding
GO:0008134	0.927	transcription factor binding
GO:0000987	0.831	cis-regulatory region sequence-specific DNA binding
GO:0140297	0.804	DNA-binding transcription factor binding
GO:0001228	0.744	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.713	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.675	enzyme binding
GO:0000978	0.556	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0044389	0.548	ubiquitin-like protein ligase binding
GO:0031625	0.533	ubiquitin protein ligase binding
GO:0061629	0.485	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0010468	0.993	regulation of gene expression
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0032502	0.974	developmental process
GO:0080090	0.958	regulation of primary metabolic process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0032501	0.937	multicellular organismal process
GO:0048518	0.928	positive regulation of biological process
GO:0048856	0.875	anatomical structure development
GO:0009893	0.856	positive regulation of metabolic process
GO:0048522	0.847	positive regulation of cellular process
GO:0007275	0.837	multicellular organism development
GO:0010604	0.834	positive regulation of macromolecule metabolic process
GO:0048519	0.792	negative regulation of biological process
GO:0051173	0.771	positive regulation of nitrogen compound metabolic process
GO:0031325	0.770	positive regulation of cellular metabolic process
GO:0048523	0.717	negative regulation of cellular process
GO:0006357	0.658	regulation of transcription by RNA polymerase II
GO:0009891	0.632	positive regulation of biosynthetic process
GO:0051254	0.632	positive regulation of RNA metabolic process
GO:0045893	0.620	positive regulation of DNA-templated transcription
GO:0050896	0.599	response to stimulus
GO:0071704	0.543	organic substance metabolic process
GO:0044238	0.540	primary metabolic process
GO:0010605	0.512	negative regulation of macromolecule metabolic process
GO:0006807	0.498	nitrogen compound metabolic process
GO:0045944	0.493	positive regulation of transcription by RNA polymerase II
GO:0045934	0.485	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.466	negative regulation of RNA metabolic process
GO:0045892	0.457	negative regulation of DNA-templated transcription
GO:0043170	0.443	macromolecule metabolic process
GO:0000122	0.391	negative regulation of transcription by RNA polymerase II
GO:0051716	0.385	cellular response to stimulus
GO:0030154	0.346	cell differentiation
GO:0009653	0.317	anatomical structure morphogenesis
GO:0009790	0.301	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.979	cytosol
GO:0032991	0.926	protein-containing complex
GO:0043232	0.709	intracellular non-membrane-bounded organelle
GO:0005739	0.510	mitochondrion
GO:0005667	0.362	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]