StarFunc result for job id Q06432

User Input

>input (222 residues)
MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKR
IPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIL
GSLCVLLSLGKKRDYLLRPASMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSW
SFACACAAFILLFLGGLALLLFSLPRMPRNPWESCMDAEPEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06432	1.000	1.000	6.644E-38	222	1.000	1.000	Q06432.pdb.gz	CCG1_HUMAN Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens OX=9606 GN=CACNG1 PE=1 SV=1
2	AFDB:P19518	0.939	0.939	1.125E-31	222	0.851	0.851	P19518.pdb.gz	CCG1_RABIT Voltage-dependent calcium channel gamma-1 subunit OS=Oryctolagus cuniculus OX=9986 GN=CACNG1 PE=1 SV=1
3	AFDB:O70578	0.966	0.962	1.252E-31	223	0.856	0.852	O70578.pdb.gz	CCG1_MOUSE Voltage-dependent calcium channel gamma-1 subunit OS=Mus musculus OX=10090 GN=Cacng1 PE=1 SV=1
4	AFDB:Q9BXT2	0.839	0.723	4.207E-17	260	0.374	0.319	Q9BXT2.pdb.gz	CCG6_HUMAN Voltage-dependent calcium channel gamma-6 subunit OS=Homo sapiens OX=9606 GN=CACNG6 PE=1 SV=1
5	PDB:6jp5E	0.710	0.929	4.807E-17	169	0.631	0.828	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
6	PDB:7jpvE	0.583	0.922	5.914E-12	139	0.500	0.799	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
7	AFDB:Q6ZP80	0.679	0.661	4.396E-10	229	0.162	0.157	Q6ZP80.pdb.gz	TM182_HUMAN Transmembrane protein 182 OS=Homo sapiens OX=9606 GN=TMEM182 PE=1 SV=2
8	AFDB:B2RVY9	0.685	0.665	6.061E-10	229	0.167	0.162	B2RVY9.pdb.gz	TM182_MOUSE Transmembrane protein 182 OS=Mus musculus OX=10090 GN=Tmem182 PE=1 SV=1
9	AFDB:A0A1D5NY17	0.679	0.650	1.092E-9	233	0.176	0.167	A0A1D5NY17.pdb.gz	TM182_CHICK Transmembrane protein 182 OS=Gallus gallus OX=9031 GN=TMEM182 PE=1 SV=2
10	AFDB:B1AQL3	0.696	0.729	1.505E-9	211	0.180	0.190	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
11	AFDB:Q8VHW8	0.704	0.579	2.189E-9	275	0.221	0.178	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
12	AFDB:Q6PFS3	0.648	0.462	2.571E-9	324	0.225	0.154	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
13	PDB:5b2gC	0.586	0.391	5.882E-8	350	0.162	0.103	5b2gC.pdb.gz
14	PDB:7ocaI	0.596	0.700	7.286E-8	185	0.212	0.254	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
15	PDB:7rz4A	0.638	0.159	8.555E-8	993	0.194	0.043	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:7rzaA	0.671	0.166	1.313E-7	981	0.162	0.037	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:5kbtA	0.583	0.148	2.495E-7	973	0.198	0.045	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
18	PDB:6ov2A	0.567	0.675	6.537E-7	182	0.144	0.176	6ov2A.pdb.gz
19	PDB:5weoA	0.600	0.152	3.086E-6	988	0.198	0.045	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
20	PDB:6wxuB	0.531	0.441	3.086E-6	273	0.140	0.114	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q06432	1.36e-167	462	222	1.000	1.000	CCG1_HUMAN Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens OX=9606 GN=CACNG1 PE=1 SV=1
2	P19518	1.94e-147	411	222	0.851	0.851	CCG1_RABIT Voltage-dependent calcium channel gamma-1 subunit OS=Oryctolagus cuniculus OX=9986 GN=CACNG1 PE=1 SV=1
3	O70578	5.48e-131	369	223	0.856	0.852	CCG1_MOUSE Voltage-dependent calcium channel gamma-1 subunit OS=Mus musculus OX=10090 GN=Cacng1 PE=1 SV=1
4	P97707	6.72e-125	354	223	0.838	0.834	CCG1_RAT Voltage-dependent calcium channel gamma-1 subunit OS=Rattus norvegicus OX=10116 GN=Cacng1 PE=1 SV=1
5	Q9BXT2	3.17e-41	142	260	0.351	0.300	CCG6_HUMAN Voltage-dependent calcium channel gamma-6 subunit OS=Homo sapiens OX=9606 GN=CACNG6 PE=1 SV=1
6	Q8VHW8	5.42e-05	45.4	275	0.239	0.193	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
7	O88602	1.43e-04	44.3	323	0.243	0.167	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
8	Q71RJ2	1.43e-04	44.3	323	0.243	0.167	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
9	Q9Y698	1.47e-04	44.3	323	0.243	0.167	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
10	Q9UF02	2.18e-04	43.5	275	0.234	0.189	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
11	Q6PFS3	0.001	41.2	324	0.234	0.160	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
12	P62955	0.007	38.9	275	0.216	0.175	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
13	P62956	0.007	38.9	275	0.216	0.175	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
14	P62957	0.007	38.9	275	0.216	0.175	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
15	O60359	0.028	37.4	315	0.221	0.156	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
16	Q8VHX0	0.034	37.0	315	0.221	0.156	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
17	Q9JJV5	0.034	37.0	315	0.221	0.156	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
18	P54825	0.13	34.7	173	0.077	0.098	LMIP_RAT Lens fiber membrane intrinsic protein OS=Rattus norvegicus OX=10116 GN=Lim2 PE=1 SV=1
19	P56563	0.14	34.7	173	0.077	0.098	LMIP_MOUSE Lens fiber membrane intrinsic protein OS=Mus musculus OX=10090 GN=Lim2 PE=1 SV=2
20	Q8VHW5	0.19	35.0	421	0.248	0.131	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01757 Acyl_transf_3	2.2e+02	12.3	Acyltransferase family
2	PF13903 Claudin_2	5.7e-38	142.1	PMP-22/EMP/MP20/Claudin tight junction
3	PF06653 Claudin_3	6.9e+02	11.6	Tight junction protein, Claudin-like
4	PF06168 DUF981	3.3e+02	12.6	Protein of unknown function (DUF981)
5	PF06305 LapA_dom	20	16.4	Lipopolysaccharide assembly protein A domain
6	PF08370 PDR_assoc	8.6e+02	11.1	Plant PDR ABC transporter associated
7	PF00822 PMP22_Claudin	3.9e-09	48.1	PMP-22/EMP/MP20/Claudin family
8	PF05473 UL45	5.1e+02	11.7	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226021

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349320	0.997	Voltage-dependent calcium channel subunit alpha-2/delta-1
2	9606.ENSP00000377840	0.989	Voltage-dependent L-type calcium channel subunit beta-1
3	9606.ENSP00000288139	0.965	Voltage-dependent L-type calcium channel subunit alpha-1D
4	9606.ENSP00000372169	0.962	Voltage-dependent calcium channel subunit alpha-2/delta-4
5	9606.ENSP00000355192	0.958	Voltage-dependent L-type calcium channel subunit alpha-1S
6	9606.ENSP00000418081	0.952	Voltage-dependent calcium channel subunit alpha-2/delta-2
7	9606.ENSP00000005284	0.947	Voltage-dependent calcium channel gamma-3 subunit
8	9606.ENSP00000262138	0.947	Voltage-dependent calcium channel gamma-4 subunit
9	9606.ENSP00000419101	0.941	Voltage-dependent calcium channel subunit alpha-2/delta-3
10	9606.ENSP00000375647	0.932	Voltage-dependent calcium channel gamma-7 subunit
11	9606.ENSP00000270458	0.931	Voltage-dependent calcium channel gamma-8 subunit
12	9606.ENSP00000300105	0.931	Voltage-dependent calcium channel gamma-2 subunit
13	9606.ENSP00000266376	0.904	Voltage-dependent L-type calcium channel subunit alpha-1C
14	9606.ENSP00000438949	0.895	Voltage-dependent L-type calcium channel subunit beta-4
15	9606.ENSP00000334198	0.890	Voltage-dependent T-type calcium channel subunit alpha-1H
16	9606.ENSP00000365441	0.868	Voltage-dependent L-type calcium channel subunit alpha-1F
17	9606.ENSP00000360423	0.866	Voltage-dependent N-type calcium channel subunit alpha-1B
18	9606.ENSP00000320025	0.859	Voltage-dependent L-type calcium channel subunit beta-2
19	9606.ENSP00000353362	0.818	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
20	9606.ENSP00000352608	0.815	Ryanodine receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.990	protein binding
GO:0016247	0.971	channel regulator activity
GO:0022843	0.881	voltage-gated monoatomic cation channel activity
GO:0099106	0.867	ion channel regulator activity
GO:0005246	0.858	calcium channel regulator activity
GO:0005262	0.830	calcium channel activity
GO:0005245	0.815	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0051924	0.965	regulation of calcium ion transport
GO:0034762	0.963	regulation of transmembrane transport
GO:1904062	0.927	regulation of monoatomic cation transmembrane transport
GO:1903169	0.920	regulation of calcium ion transmembrane transport
GO:0009987	0.889	cellular process
GO:0006811	0.331	monoatomic ion transport
GO:0030001	0.322	metal ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030315	0.999	T-tubule
GO:0005891	0.999	voltage-gated calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.831	Ca(2+)(in) = Ca(2+)(out)

[back to server]