StarFunc result for job id Q06455

User Input

>input (604 residues)
MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPP
TTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGA
RQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPF
VIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENG
KRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHL
LNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMIT
TERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQ
HKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIE
TTPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54972	0.244	0.238	2.317E-54	620	0.710	0.692	O54972.pdb.gz	MTG16_MOUSE Protein CBFA2T3 OS=Mus musculus OX=10090 GN=Cbfa2t3 PE=1 SV=2
2	AFDB:O43439	0.374	0.374	2.496E-51	604	0.619	0.619	O43439.pdb.gz	MTG8R_HUMAN Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2 PE=1 SV=1
3	AFDB:J3KTH2	0.152	0.110	3.643E-5	867	0.127	0.089	J3KTH2.pdb.gz	J3KTH2_HUMAN HCG38478, isoform CRA_a OS=Homo sapiens OX=9606 GN=TAF4B PE=1 SV=1
4	AFDB:A0A087WVZ6	0.110	0.069	2.150E-3	1136	0.119	0.063	A0A087WVZ6.pdb.gz	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
5	AFDB:D4ABV2	0.115	0.075	4.150E-2	1006	0.106	0.064	D4ABV2.pdb.gz	D4ABV2_RAT Centrosomal protein 112 OS=Rattus norvegicus OX=10116 GN=Cep112 PE=4 SV=4
6	AFDB:Q5SZL2	0.118	0.094	5.189E-2	805	0.131	0.098	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
7	AFDB:P33205	0.062	0.084	6.136E-2	399	0.098	0.148	P33205.pdb.gz	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
8	AFDB:X6RFI8	0.107	0.097	7.256E-2	677	0.132	0.118	X6RFI8.pdb.gz	X6RFI8_HUMAN RAB11 family interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
9	AFDB:Q86Y26	0.069	0.044	7.672E-2	1132	0.134	0.072	Q86Y26.pdb.gz	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
10	AFDB:B3DGF9	0.071	0.084	8.579E-2	441	0.098	0.134	B3DGF9.pdb.gz
11	PDB:5v3hA	0.078	0.107	3.289E-1	438	0.023	0.032	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
12	PDB:3n71A	0.071	0.091	5.142E-1	468	0.023	0.030	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
13	PDB:5ex0A	0.069	0.095	7.189E-1	429	0.023	0.033	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
14	PDB:8a2qB	0.069	0.042	1.965	1084	0.043	0.024	8a2qB.pdb.gz
15	PDB:6vvoE	0.074	0.111	2.078	346	0.025	0.043	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
16	PDB:3o8jA	0.059	0.081	2.598	364	0.031	0.052	3o8jA.pdb.gz
17	PDB:5xtcg	0.045	0.177	3.435	119	0.031	0.160	5xtcg.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:3iqcA	0.057	0.219	4.295	119	0.020	0.101	3iqcA.pdb.gz
19	PDB:4k80A	0.061	0.134	4.295	209	0.030	0.086	4k80A.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
20	PDB:3hwkE	0.048	0.068	4.542	367	0.015	0.025	3hwkE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSU1	0.0	1188	663	0.952	0.867	A0A0A0MSU1_HUMAN RUNX1 partner transcriptional co-repressor 1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=1
2	H3BNH2	0.0	561	418	0.495	0.715	H3BNH2_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=8
3	O43439	0.0	728	604	0.594	0.594	MTG8R_HUMAN Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2 PE=1 SV=1
4	O54972	0.0	799	620	0.704	0.685	MTG16_MOUSE Protein CBFA2T3 OS=Mus musculus OX=10090 GN=Cbfa2t3 PE=1 SV=2
5	O70374	0.0	718	594	0.586	0.596	MTG8R_MOUSE Protein CBFA2T2 OS=Mus musculus OX=10090 GN=Cbfa2t2 PE=1 SV=3
6	O75081	0.0	809	653	0.700	0.648	MTG16_HUMAN Protein CBFA2T3 OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=2
7	Q06455	0.0	1256	604	1.000	1.000	MTG8_HUMAN Protein CBFA2T1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=2
8	Q61909	0.0	1182	577	0.945	0.990	MTG8_MOUSE Protein CBFA2T1 OS=Mus musculus OX=10090 GN=Runx1t1 PE=2 SV=1
9	Q9IAB2	0.0	687	586	0.589	0.608	MTG8R_XENLA Protein CBFA2T2 OS=Xenopus laevis OX=8355 GN=cbfa2t2 PE=2 SV=2
10	W8FW32	0.0	1175	567	0.939	1.000	W8FW32_HUMAN CBFA2T1 isoform r1t1-7d56 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=2 SV=1
11	Q24037	3.53e-34	140	743	0.124	0.101	Q24037_DROME Nervy OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=1
12	A0A0B4KEZ2	4.95e-34	140	757	0.124	0.099	A0A0B4KEZ2_DROME Nervy, isoform D OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
13	Q9W186	5.09e-34	140	743	0.124	0.101	Q9W186_DROME LD17501p OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=2
14	A0A0B4KFZ8	5.17e-34	140	742	0.124	0.101	A0A0B4KFZ8_DROME Nervy, isoform B OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
15	H3BSI4	2.31e-31	120	132	0.132	0.606	H3BSI4_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=1
16	H3BNI7	1.40e-15	75.9	130	0.086	0.400	H3BNI7_HUMAN CBFA2/RUNX1 partner transcriptional co-repressor 3 (Fragment) OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=1
17	O75398	1.83e-14	79.0	565	0.056	0.060	DEAF1_HUMAN Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1 PE=1 SV=1
18	Q9Z1T5	8.06e-14	76.6	566	0.060	0.064	DEAF1_MOUSE Deformed epidermal autoregulatory factor 1 homolog OS=Mus musculus OX=10090 GN=Deaf1 PE=1 SV=1
19	O88450	8.26e-14	76.6	565	0.060	0.064	DEAF1_RAT Deformed epidermal autoregulatory factor 1 homolog OS=Rattus norvegicus OX=10116 GN=Deaf1 PE=1 SV=1
20	Q24180	4.71e-05	48.9	576	0.056	0.059	DEAF1_DROME Deformed epidermal autoregulatory factor 1 OS=Drosophila melanogaster OX=7227 GN=Deaf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12531 DUF3731	3.3e+02	12.5	DNA-K related protein
2	PF10153 Efg1	63	15.4	rRNA-processing protein Efg1
3	PF08788 NHR2	1.5e-36	135.3	NHR2 domain like
4	PF07531 TAFH	2.8e-31	118.8	NHR1 homology to TAF
5	PF01753 zf-MYND	0.002	29.5	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000034918

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000056927	0.962	Nuclear receptor corepressor 2
2	9598.ENSPTRP00000012156	0.941	Transcription factor 12
3	9598.ENSPTRP00000053966	0.914	Runt-related transcription factor
4	9598.ENSPTRP00000060659	0.881	Histone deacetylase
5	9598.ENSPTRP00000059137	0.865	Nuclear receptor corepressor 1
6	9598.ENSPTRP00000006192	0.849	Spi-1 proto-oncogene
7	9598.ENSPTRP00000013857	0.764	Uncharacterized protein
8	9598.ENSPTRP00000025724	0.717	Protein kinase, cAMP-dependent, regulatory, type II, alpha
9	9598.ENSPTRP00000001230	0.687	TAL bHLH transcription factor 1, erythroid differentiation factor
10	9598.ENSPTRP00000013322	0.675	Myosin, heavy chain 11, smooth muscle
11	9598.ENSPTRP00000028672	0.641	Uncharacterized protein
12	9598.ENSPTRP00000013851	0.640	Uncharacterized protein
13	9598.ENSPTRP00000053041	0.603	Uncharacterized protein
14	9598.ENSPTRP00000041014	0.602	Zinc finger MYND domain-containing protein 10
15	9598.ENSPTRP00000007389	0.600	Zinc finger and BTB domain containing 16
16	9598.ENSPTRP00000022026	0.585	Receptor protein-tyrosine kinase
17	9598.ENSPTRP00000057740	0.584	Protein phosphatase 2, regulatory subunit B, beta
18	9598.ENSPTRP00000008274	0.572	Prickle homolog 1
19	9598.ENSPTRP00000018126	0.567	A kinase (PRKA) anchor protein 8
20	9598.ENSPTRP00000028671	0.567	Iroquois homeobox 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0008134	0.845	transcription factor binding
GO:0140297	0.812	DNA-binding transcription factor binding
GO:0003682	0.429	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.997	regulation of primary metabolic process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048523	0.987	negative regulation of cellular process
GO:0031324	0.972	negative regulation of cellular metabolic process
GO:0045892	0.927	negative regulation of DNA-templated transcription
GO:0009987	0.865	cellular process
GO:0032502	0.854	developmental process
GO:0065009	0.809	regulation of molecular function
GO:0032501	0.802	multicellular organismal process
GO:0048856	0.788	anatomical structure development
GO:0048869	0.679	cellular developmental process
GO:0007275	0.655	multicellular organism development
GO:0030154	0.653	cell differentiation
GO:0006357	0.595	regulation of transcription by RNA polymerase II
GO:0048518	0.588	positive regulation of biological process
GO:0048731	0.576	system development
GO:0009893	0.439	positive regulation of metabolic process
GO:0050793	0.417	regulation of developmental process
GO:0010604	0.407	positive regulation of macromolecule metabolic process
GO:0048522	0.385	positive regulation of cellular process
GO:0045595	0.385	regulation of cell differentiation
GO:0050896	0.382	response to stimulus
GO:0000122	0.342	negative regulation of transcription by RNA polymerase II
GO:0048468	0.334	cell development
GO:0051173	0.307	positive regulation of nitrogen compound metabolic process
GO:0031325	0.307	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.491	intracellular non-membrane-bounded organelle
GO:0032991	0.430	protein-containing complex
GO:0005737	0.392	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]