StarFunc result for job id Q06481

User Input

>input (763 residues)
MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDK
KQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMT
LYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEF
PTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDK
EITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC
KAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQ
SDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERR
NQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFH
PFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGLIGAEEKVINSKNKVDENMVIDETLD
VKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVISLVMLRKRQ
YGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15943	0.613	0.612	0.000	765	0.931	0.928	P15943.pdb.gz	APLP2_RAT Amyloid beta precursor like protein 2 OS=Rattus norvegicus OX=10116 GN=Aplp2 PE=1 SV=2
2	AFDB:Q06335	0.315	0.338	4.415E-84	707	0.818	0.883	Q06335.pdb.gz	APLP2_MOUSE Amyloid beta precursor like protein 2 OS=Mus musculus OX=10090 GN=Aplp2 PE=1 SV=4
3	AFDB:P05067	0.293	0.290	4.029E-71	770	0.510	0.505	P05067.pdb.gz	A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3
4	AFDB:B0V0E5	0.329	0.333	2.276E-68	751	0.490	0.498	B0V0E5.pdb.gz	B0V0E5_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=appb PE=1 SV=1
5	AFDB:A0A0R4IN41	0.302	0.311	1.471E-64	738	0.464	0.480	A0A0R4IN41.pdb.gz
6	AFDB:A0A0R4IZ16	0.289	0.322	2.870E-53	682	0.414	0.463	A0A0R4IZ16.pdb.gz
7	AFDB:Q03157	0.301	0.349	4.651E-47	653	0.370	0.432	Q03157.pdb.gz	APLP1_MOUSE Amyloid beta precursor like protein 1 OS=Mus musculus OX=10090 GN=Aplp1 PE=1 SV=2
8	AFDB:P51693	0.309	0.359	8.207E-46	650	0.363	0.426	P51693.pdb.gz	APLP1_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=3
9	AFDB:Q10651	0.427	0.468	1.324E-33	686	0.265	0.294	Q10651.pdb.gz	A4_CAEEL Amyloid-beta-like protein OS=Caenorhabditis elegans OX=6239 GN=apl-1 PE=1 SV=2
10	AFDB:F1R8S2	0.147	0.299	1.169E-13	362	0.152	0.320	F1R8S2.pdb.gz
11	PDB:3bybA	0.068	0.874	5.194E-5	58	0.031	0.414	3bybA.pdb.gz
12	PDB:4bd9B	0.071	0.315	5.194E-5	165	0.035	0.164	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
13	PDB:2m01A	0.067	0.733	1.049E-2	59	0.028	0.356	2m01A.pdb.gz
14	PDB:4gyoB	0.062	0.111	5.466E-1	359	0.045	0.095	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
15	PDB:3m62A	0.067	0.059	7.565E-1	955	0.047	0.038	3m62A.pdb.gz
16	PDB:1tt9A	0.116	0.148	9.395E-1	540	0.028	0.039	1tt9A.pdb.gz
17	PDB:3zhpA	0.072	0.123	1.047	315	0.024	0.057	3zhpA.pdb.gz
18	PDB:4n78F	0.081	0.282	1.232	156	0.025	0.122	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
19	PDB:3iqcA	0.070	0.287	1.300	119	0.022	0.143	3iqcA.pdb.gz
20	PDB:6c0fz	0.073	0.149	1.300	243	0.038	0.119	6c0fz.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V0E5	0.0	710	751	0.490	0.498	B0V0E5_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=appb PE=1 SV=1
2	P15943	0.0	1342	765	0.894	0.892	APLP2_RAT Amyloid beta precursor like protein 2 OS=Rattus norvegicus OX=10116 GN=Aplp2 PE=1 SV=2
3	Q06335	0.0	1189	707	0.792	0.854	APLP2_MOUSE Amyloid beta precursor like protein 2 OS=Mus musculus OX=10090 GN=Aplp2 PE=1 SV=4
4	Q06481	0.0	1590	763	1.000	1.000	APLP2_HUMAN Amyloid beta precursor like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2
5	P12023	5.30e-155	471	770	0.337	0.334	A4_MOUSE Amyloid-beta precursor protein OS=Mus musculus OX=10090 GN=App PE=1 SV=3
6	P08592	1.63e-154	470	770	0.336	0.332	A4_RAT Amyloid-beta precursor protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=2
7	P05067	1.00e-151	463	770	0.332	0.329	A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3
8	Q6NUZ1	1.49e-143	441	738	0.313	0.324	Q6NUZ1_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=wu:fj08a12 PE=2 SV=1
9	Q08E54	4.52e-123	386	695	0.287	0.315	Q08E54_BOVIN Amyloid-beta A4 protein OS=Bos taurus OX=9913 GN=APP PE=2 SV=1
10	Q8UUR9	3.64e-112	357	694	0.261	0.287	Q8UUR9_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=zgc:92771 PE=2 SV=1
11	F5GZ08	3.64e-91	300	611	0.223	0.278	F5GZ08_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
12	P51693	5.18e-91	300	650	0.225	0.265	APLP1_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=3
13	B7Z4G8	7.31e-91	300	644	0.223	0.264	B7Z4G8_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
14	Q03157	8.06e-86	286	654	0.235	0.274	APLP1_MOUSE Amyloid beta precursor like protein 1 OS=Mus musculus OX=10090 GN=Aplp1 PE=1 SV=2
15	A0A8I6AD03	2.53e-85	285	655	0.231	0.269	A0A8I6AD03_RAT Amyloid beta precursor like protein 1 OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=3 SV=1
16	B1WBV6	3.41e-83	280	644	0.224	0.266	B1WBV6_RAT Aplp1 protein OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=2 SV=1
17	F1LRS5	1.72e-82	277	636	0.220	0.264	F1LRS5_RAT Amyloid beta precursor like protein 1 OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=3 SV=3
18	S4R3U6	5.34e-68	228	289	0.182	0.481	S4R3U6_HUMAN Amyloid beta precursor like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
19	Q4ZHV6	2.39e-37	152	804	0.092	0.087	Q4ZHV6_MANSE Beta amyloid protein-like protein OS=Manduca sexta OX=7130 PE=1 SV=3
20	Q10651	3.98e-35	144	686	0.090	0.101	A4_CAEEL Amyloid-beta-like protein OS=Caenorhabditis elegans OX=6239 GN=apl-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10515 APP_amyloid	7.9e-22	88.9	Beta-amyloid precursor protein C-terminus
2	PF12924 APP_Cu_bd	5.2e-22	89.6	Copper-binding of amyloid precursor, CuBD
3	PF12925 APP_E2	3e-66	234.2	E2 domain of amyloid precursor protein
4	PF02177 APP_N	1.9e-38	142.2	Amyloid A4 N-terminal heparin-binding
5	PF10070 DabA	5.7e+02	10.2	Probable inorganic carbon transporter subunit DabA
6	PF00014 Kunitz_BPTI	3e-16	70.7	Kunitz/Bovine pancreatic trypsin inhibitor domain
7	PF06056 Terminase_5	4.9e+02	12.0	Putative ATPase subunit of terminase (gpP-like)
8	PF16975 UPAR_LY6_2	9.8e+02	11.4	Ly6/PLAUR domain-containing protein 6, Lypd6
9	PF17211 VHL_C	1e+02	14.2	VHL box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477213	0.989	Amyloid-beta A4 precursor protein-binding family B member 1
2	9606.ENSP00000427211	0.914	Amyloid-beta A4 precursor protein-binding family B member 2
3	9606.ENSP00000284981	0.856	Amyloid-beta A4 protein
4	9606.ENSP00000346378	0.814	Amyloid-beta A4 precursor protein-binding family B member 3
5	9606.ENSP00000315136	0.788	Amyloid-beta A4 precursor protein-binding family A member 3
6	9606.ENSP00000303208	0.785	Proprotein convertase subtilisin/kexin type 9
7	9606.ENSP00000241014	0.780	C-Jun-amino-terminal kinase-interacting protein 1
8	9606.ENSP00000318585	0.759	Beta-secretase 1
9	9606.ENSP00000260408	0.750	Disintegrin and metalloproteinase domain-containing protein 10
10	9606.ENSP00000354280	0.744	Trypsin-3
11	9606.ENSP00000326366	0.743	Presenilin-1
12	9606.ENSP00000265381	0.724	Amyloid-beta A4 precursor protein-binding family A member 1
13	9606.ENSP00000453293	0.721	Amyloid-beta A4 precursor protein-binding family A member 2
14	9606.ENSP00000294785	0.715	Nicastrin
15	9606.ENSP00000360280	0.709	Disabled homolog 1
16	9606.ENSP00000355747	0.688	Presenilin-2
17	9606.ENSP00000288266	0.668	DCC-interacting protein 13-alpha
18	9606.ENSP00000354040	0.656	Nucleolar GTP-binding protein 1
19	9606.ENSP00000368752	0.653	Major prion protein
20	9606.ENSP00000340330	0.643	Histone acetyltransferase KAT5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.740	molecular function regulator activity
GO:0005102	0.635	signaling receptor binding
GO:0030234	0.521	enzyme regulator activity
GO:0042802	0.434	identical protein binding
GO:0061134	0.396	peptidase regulator activity
GO:0004857	0.373	enzyme inhibitor activity
GO:0030414	0.332	peptidase inhibitor activity
GO:0061135	0.318	endopeptidase regulator activity
GO:0004866	0.301	endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032501	0.968	multicellular organismal process
GO:0048856	0.953	anatomical structure development
GO:0019222	0.950	regulation of metabolic process
GO:0007399	0.939	nervous system development
GO:0071704	0.925	organic substance metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0051174	0.911	regulation of phosphorus metabolic process
GO:0048518	0.910	positive regulation of biological process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0010646	0.893	regulation of cell communication
GO:0080090	0.891	regulation of primary metabolic process
GO:0007417	0.891	central nervous system development
GO:0016043	0.887	cellular component organization
GO:0048583	0.876	regulation of response to stimulus
GO:0023051	0.871	regulation of signaling
GO:0050896	0.867	response to stimulus
GO:0048522	0.866	positive regulation of cellular process
GO:0048519	0.826	negative regulation of biological process
GO:0019220	0.816	regulation of phosphate metabolic process
GO:0051246	0.810	regulation of protein metabolic process
GO:0009966	0.793	regulation of signal transduction
GO:0042325	0.776	regulation of phosphorylation
GO:0001932	0.772	regulation of protein phosphorylation
GO:0051338	0.770	regulation of transferase activity
GO:0048523	0.734	negative regulation of cellular process
GO:0045859	0.687	regulation of protein kinase activity
GO:0044238	0.677	primary metabolic process
GO:0010605	0.646	negative regulation of macromolecule metabolic process
GO:0051098	0.616	regulation of binding
GO:0050730	0.590	regulation of peptidyl-tyrosine phosphorylation
GO:0009893	0.535	positive regulation of metabolic process
GO:0043170	0.513	macromolecule metabolic process
GO:0010604	0.492	positive regulation of macromolecule metabolic process
GO:0051716	0.481	cellular response to stimulus
GO:0051173	0.478	positive regulation of nitrogen compound metabolic process
GO:0050793	0.477	regulation of developmental process
GO:0006807	0.475	nitrogen compound metabolic process
GO:0043393	0.429	regulation of protein binding
GO:0010468	0.426	regulation of gene expression
GO:0010469	0.395	regulation of signaling receptor activity
GO:1901564	0.346	organonitrogen compound metabolic process
GO:0023052	0.343	signaling
GO:0009889	0.334	regulation of biosynthetic process
GO:0009653	0.328	anatomical structure morphogenesis
GO:0042221	0.320	response to chemical
GO:0007154	0.319	cell communication
GO:0007165	0.314	signal transduction
GO:0019538	0.313	protein metabolic process
GO:0045595	0.305	regulation of cell differentiation
GO:0044237	0.301	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0005576	0.998	extracellular region
GO:0031410	0.996	cytoplasmic vesicle
GO:0070013	0.992	intracellular organelle lumen
GO:0099503	0.990	secretory vesicle
GO:0005634	0.983	nucleus
GO:0031090	0.976	organelle membrane
GO:0030659	0.974	cytoplasmic vesicle membrane
GO:0098588	0.971	bounding membrane of organelle
GO:0005615	0.921	extracellular space
GO:0070062	0.884	extracellular exosome
GO:0005783	0.818	endoplasmic reticulum
GO:0030054	0.807	cell junction
GO:0031981	0.792	nuclear lumen
GO:0005654	0.777	nucleoplasm
GO:0043005	0.756	neuron projection
GO:0005794	0.738	Golgi apparatus
GO:0045202	0.690	synapse
GO:0030141	0.686	secretory granule
GO:0030667	0.506	secretory granule membrane
GO:0005788	0.473	endoplasmic reticulum lumen
GO:0031091	0.452	platelet alpha granule
GO:0036477	0.425	somatodendritic compartment
GO:0005768	0.373	endosome
GO:0005829	0.317	cytosol
GO:0009986	0.312	cell surface
GO:0032991	0.310	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]