StarFunc result for job id Q06546

User Input

>input (454 residues)
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8IE48	0.533	0.533	2.303E-70	454	1.000	1.000	A8IE48.pdb.gz	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
2	AFDB:Q04688	0.263	0.258	6.661E-33	464	0.350	0.343	Q04688.pdb.gz	ELG_DROME DNA-binding protein Ets97D OS=Drosophila melanogaster OX=7227 GN=Ets97D PE=1 SV=2
3	AFDB:A0A590UJP9	0.222	0.200	2.085E-19	504	0.275	0.248	A0A590UJP9.pdb.gz	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
4	AFDB:P15036	0.263	0.255	2.085E-19	469	0.273	0.264	P15036.pdb.gz	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
5	AFDB:D4AAH4	0.222	0.215	5.642E-19	470	0.269	0.260	D4AAH4.pdb.gz	D4AAH4_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=2
6	AFDB:A0A076VF89	0.228	0.239	5.963E-19	432	0.256	0.269	A0A076VF89.pdb.gz
7	AFDB:P10157	0.270	0.258	1.705E-18	479	0.262	0.248	P10157.pdb.gz	ETS2_CHICK Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1
8	AFDB:P14921	0.222	0.229	2.127E-18	441	0.264	0.272	P14921.pdb.gz	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
9	AFDB:A0A024R3M5	0.192	0.193	1.739E-17	452	0.247	0.248	A0A024R3M5.pdb.gz
10	AFDB:Q7SXF5	0.188	0.184	2.423E-17	466	0.256	0.249	Q7SXF5.pdb.gz
11	PDB:2qb0B	0.141	0.262	1.135E-2	241	0.055	0.104	2qb0B.pdb.gz	Polymer-driven crystallization.
12	PDB:6mdhA	0.108	0.299	2.375E-1	149	0.024	0.074	6mdhA.pdb.gz
13	PDB:3j797	0.127	0.418	1.117	96	0.018	0.083	3j797.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
14	PDB:3dbhI	0.107	0.484	1.181	86	0.020	0.105	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:4zzlA	0.104	0.221	1.181	146	0.035	0.110	4zzlA.pdb.gz
16	PDB:4v6wCd	0.113	0.287	1.319	111	0.020	0.081	4v6wCd.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:6yvaC	0.099	0.264	1.319	155	0.024	0.071	6yvaC.pdb.gz
18	PDB:6jmiA	0.084	0.290	1.556	100	0.020	0.090	6jmiA.pdb.gz
19	PDB:7vb2A	0.086	0.181	1.556	165	0.048	0.133	7vb2A.pdb.gz
20	PDB:3ai5A	0.106	0.156	1.645	299	0.022	0.033	3ai5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8IE48	0.0	937	454	1.000	1.000	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
2	Q00422	0.0	882	454	0.960	0.960	GABPA_MOUSE GA-binding protein alpha chain OS=Mus musculus OX=10090 GN=Gabpa PE=1 SV=2
3	Q06546	0.0	937	454	1.000	1.000	GABPA_HUMAN GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1
4	Q04688	8.93e-84	267	464	0.363	0.356	ELG_DROME DNA-binding protein Ets97D OS=Drosophila melanogaster OX=7227 GN=Ets97D PE=1 SV=2
5	P26323	1.26e-47	171	452	0.227	0.228	FLI1_MOUSE Friend leukemia integration 1 transcription factor OS=Mus musculus OX=10090 GN=Fli1 PE=1 SV=1
6	Q01543	2.06e-47	171	452	0.229	0.230	FLI1_HUMAN Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1
7	P81270	1.13e-46	170	486	0.220	0.206	ERG_MOUSE Transcriptional regulator ERG OS=Mus musculus OX=10090 GN=Erg PE=1 SV=2
8	P11308	2.49e-46	169	479	0.218	0.207	ERG_HUMAN Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=3
9	Q9PU61	1.22e-45	166	451	0.203	0.204	Q9PU61_DANRE Fli-1 protein OS=Danio rerio OX=7955 GN=fli1a PE=1 SV=1
10	A0A2R8QGN6	1.39e-45	166	460	0.203	0.200	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
11	Q5MBG6	2.64e-45	166	458	0.211	0.210	Q5MBG6_DANRE ETS family transcription factor efr1 OS=Danio rerio OX=7955 GN=fli1b PE=2 SV=1
12	Q5PR65	7.87e-41	152	427	0.214	0.227	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
13	P10157	2.46e-39	149	479	0.145	0.138	ETS2_CHICK Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1
14	P41156	2.54e-39	149	441	0.143	0.147	ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus OX=10116 GN=Ets1 PE=1 SV=1
15	P14921	2.70e-39	149	441	0.143	0.147	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
16	P27577	2.97e-39	149	440	0.143	0.148	ETS1_MOUSE Protein C-ets-1 OS=Mus musculus OX=10090 GN=Ets1 PE=1 SV=2
17	P15036	1.09e-37	145	469	0.139	0.134	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
18	P15037	1.09e-37	145	468	0.139	0.135	ETS2_MOUSE Protein C-ets-2 OS=Mus musculus OX=10090 GN=Ets2 PE=1 SV=1
19	A0A590UJP9	1.38e-37	145	504	0.139	0.125	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
20	A0A8I5ZS11	1.47e-37	145	494	0.139	0.128	A0A8I5ZS11_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	5.6e-29	111.6	Ets-domain
2	PF11620 GABP-alpha	2.8e-28	109.3	GA-binding protein alpha chain
3	PF00447 HSF_DNA-bind	7.5e+02	12.1	HSF-type DNA-binding
4	PF02198 SAM_PNT	8.6e-26	101.1	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000024204

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023609	0.987	GA binding protein transcription factor, beta subunit 1
2	61853.ENSNLEP00000012303	0.931	GA binding protein transcription factor, beta subunit 2
3	61853.ENSNLEP00000014937	0.806	Transcription factor A, mitochondrial
4	61853.ENSNLEP00000018952	0.740	rRNA adenine N(6)-methyltransferase
5	61853.ENSNLEP00000005018	0.698	rRNA adenine N(6)-methyltransferase
6	61853.ENSNLEP00000000082	0.616	SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
7	61853.ENSNLEP00000018245	0.609	Peroxisome proliferator-activated receptor gamma, coactivator-related 1
8	61853.ENSNLEP00000000934	0.604	DNA-directed RNA polymerase
9	61853.ENSNLEP00000022671	0.592	Single-stranded DNA-binding protein
10	61853.ENSNLEP00000018018	0.581	Twinkle mtDNA helicase
11	61853.ENSNLEP00000021322	0.578	Zinc finger protein 143
12	61853.ENSNLEP00000015381	0.570	Nuclear respiratory factor 1
13	61853.ENSNLEP00000019547	0.558	Kruppel-like factor 5 (intestinal)
14	61853.ENSNLEP00000019712	0.557	NK3 homeobox 2
15	61853.ENSNLEP00000016641	0.551	Kruppel-like factor 11
16	61853.ENSNLEP00000009011	0.550	Histone H4 transcription factor
17	61853.ENSNLEP00000018748	0.541	E1A binding protein p300
18	61853.ENSNLEP00000018430	0.530	SUFU negative regulator of hedgehog signaling
19	61853.ENSNLEP00000017424	0.529	Zinc finger protein 219
20	61853.ENSNLEP00000012245	0.524	NK2 homeobox 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0006357	0.990	regulation of transcription by RNA polymerase II
GO:0009987	0.986	cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0009891	0.948	positive regulation of biosynthetic process
GO:0048522	0.931	positive regulation of cellular process
GO:0010604	0.923	positive regulation of macromolecule metabolic process
GO:0031325	0.884	positive regulation of cellular metabolic process
GO:0051173	0.882	positive regulation of nitrogen compound metabolic process
GO:0045935	0.873	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.826	positive regulation of RNA metabolic process
GO:0050896	0.821	response to stimulus
GO:0045893	0.818	positive regulation of DNA-templated transcription
GO:0051716	0.744	cellular response to stimulus
GO:0042221	0.741	response to chemical
GO:0071867	0.721	response to monoamine
GO:0071869	0.685	response to catecholamine
GO:0009892	0.656	negative regulation of metabolic process
GO:0051172	0.649	negative regulation of nitrogen compound metabolic process
GO:0048523	0.648	negative regulation of cellular process
GO:0031324	0.632	negative regulation of cellular metabolic process
GO:1903350	0.624	response to dopamine
GO:0032502	0.598	developmental process
GO:0045944	0.592	positive regulation of transcription by RNA polymerase II
GO:0009719	0.587	response to endogenous stimulus
GO:0010605	0.566	negative regulation of macromolecule metabolic process
GO:0070887	0.563	cellular response to chemical stimulus
GO:0032501	0.559	multicellular organismal process
GO:0048856	0.549	anatomical structure development
GO:0071870	0.545	cellular response to catecholamine stimulus
GO:0045934	0.496	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.480	negative regulation of biosynthetic process
GO:0007275	0.440	multicellular organism development
GO:0031327	0.430	negative regulation of cellular biosynthetic process
GO:0051253	0.389	negative regulation of RNA metabolic process
GO:0010558	0.386	negative regulation of macromolecule biosynthetic process
GO:1903507	0.384	negative regulation of nucleic acid-templated transcription
GO:0045892	0.355	negative regulation of DNA-templated transcription
GO:0000122	0.346	negative regulation of transcription by RNA polymerase II
GO:0008152	0.319	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.855	intracellular non-membrane-bounded organelle
GO:0005737	0.494	cytoplasm
GO:0005694	0.343	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]