StarFunc result for job id Q06547

User Input

>input (395 residues)
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS
SETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANRE
AQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06547	1.000	1.000	3.948E-54	395	1.000	1.000	Q06547.pdb.gz	GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=2
2	AFDB:Q8TAK5	0.433	0.383	1.332E-35	448	0.676	0.596	Q8TAK5.pdb.gz	GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens OX=9606 GN=GABPB2 PE=1 SV=1
3	AFDB:P81069	0.428	0.408	1.841E-30	414	0.605	0.577	P81069.pdb.gz	GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus OX=10090 GN=Gabpb2 PE=1 SV=2
4	AFDB:M9NFF9	0.403	0.274	3.018E-16	583	0.301	0.204	M9NFF9.pdb.gz	M9NFF9_DROME Ada2a-containing complex component 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Atac3 PE=4 SV=1
5	PDB:6mwqA	0.373	0.300	1.448E-13	493	0.253	0.203	6mwqA.pdb.gz
6	AFDB:A0A0G2K7U7	0.384	0.146	1.608E-13	1054	0.197	0.074	A0A0G2K7U7.pdb.gz	A0A0G2K7U7_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
7	AFDB:Q0KIE7	0.379	0.098	2.190E-13	1549	0.180	0.046	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
8	AFDB:A0A0G2JVS9	0.378	0.143	6.454E-13	1055	0.205	0.077	A0A0G2JVS9.pdb.gz	A0A0G2JVS9_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
9	AFDB:Q96NW4	0.385	0.147	1.197E-12	1050	0.185	0.070	Q96NW4.pdb.gz	ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2
10	AFDB:Q9VBP3	0.396	0.136	1.260E-12	1181	0.180	0.060	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
11	AFDB:Q9NCP8	0.372	0.130	1.630E-12	1159	0.177	0.060	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	PDB:2dvwA	0.371	0.631	5.965E-11	229	0.127	0.218	2dvwA.pdb.gz
13	PDB:8cs9A	0.392	0.196	9.003E-11	796	0.122	0.060	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:6jd6B	0.373	0.737	7.922E-9	192	0.104	0.214	6jd6B.pdb.gz
15	PDB:5vkqA	0.350	0.095	1.325E-8	1499	0.132	0.035	5vkqA.pdb.gz
16	PDB:1bd8A	0.370	0.903	2.217E-8	156	0.119	0.301	1bd8A.pdb.gz
17	PDB:4oauC	0.354	0.206	3.179E-8	692	0.122	0.069	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
18	PDB:6v9hC	0.351	0.508	3.906E-8	270	0.116	0.170	6v9hC.pdb.gz
19	PDB:1wg0A	0.374	0.600	4.112E-8	243	0.104	0.169	1wg0A.pdb.gz
20	PDB:6pqpA	0.379	0.247	1.276E-7	615	0.101	0.065	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H7I4	0.0	644	319	0.808	1.000	F5H7I4_HUMAN GA binding protein transcription factor subunit beta 1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=1
2	Q00420	0.0	764	383	0.952	0.982	GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus OX=10090 GN=Gabpb1 PE=1 SV=2
3	Q06547	0.0	806	395	1.000	1.000	GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=2
4	Q8TAK5	1.72e-170	486	448	0.694	0.612	GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens OX=9606 GN=GABPB2 PE=1 SV=1
5	P81069	6.45e-151	434	414	0.618	0.589	GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus OX=10090 GN=Gabpb2 PE=1 SV=2
6	Q9W0R7	4.38e-40	152	576	0.190	0.130	Q9W0R7_DROME Ada2a-containing complex component 3, isoform B OS=Drosophila melanogaster OX=7227 GN=Atac3 PE=4 SV=3
7	M9NFF9	5.83e-40	151	583	0.190	0.129	M9NFF9_DROME Ada2a-containing complex component 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Atac3 PE=4 SV=1
8	A0A0R4IYN3	2.36e-21	99.0	1274	0.144	0.045	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
9	A3KGU1	2.40e-21	98.6	1267	0.144	0.045	A3KGU1_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=LOC567533 PE=2 SV=1
10	O95271	8.36e-21	97.1	1327	0.142	0.042	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
11	Q9H2K2	8.82e-21	97.1	1166	0.139	0.047	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1
12	Q3UES3	1.22e-20	96.7	1166	0.139	0.047	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
13	Q6PFX9	1.42e-20	96.3	1320	0.144	0.043	TNKS1_MOUSE Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1
14	D3Z8Q6	2.10e-20	95.9	1317	0.142	0.043	D3Z8Q6_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
15	A0A8I5YBL7	2.22e-20	95.9	1313	0.142	0.043	A0A8I5YBL7_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
16	E7EWY6	4.09e-20	94.7	617	0.139	0.089	E7EWY6_HUMAN Tankyrase OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=1
17	F6NJE0	4.44e-20	94.7	728	0.147	0.080	F6NJE0_DANRE Ankyrin repeat domain 6b OS=Danio rerio OX=7955 GN=ankrd6 PE=4 SV=1
18	Q24241	2.30e-19	92.8	1549	0.137	0.035	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
19	Q0KIE7	2.76e-19	92.4	1549	0.137	0.035	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
20	Q9VBP3	4.45e-19	92.0	1181	0.142	0.047	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13476 AAA_23	67	15.4	AAA domain
2	PF00023 Ank	7.1e-19	78.6	Ankyrin repeat
3	PF12796 Ank_2	1.4e-32	123.5	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	3.7e-16	68.4	Ankyrin repeat
5	PF13637 Ank_4	2e-17	74.6	Ankyrin repeats (many copies)
6	PF13857 Ank_5	5.2e-20	82.5	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006168830.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006157752.1	0.984	GA-binding protein alpha chain
2	246437.XP_006167139.1	0.788	Tumor protein D54
3	246437.XP_006140045.1	0.784	Transcription factor B1, mitochondrial
4	246437.XP_006147121.1	0.774	Transcription factor A, mitochondrial
5	246437.XP_006157345.1	0.672	Transcription factor B2, mitochondrial
6	246437.XP_006171802.1	0.672	annotation not available
7	246437.XP_006167277.1	0.654	YY1-associated factor 2
8	246437.XP_006150707.1	0.645	Transforming protein p68/c-ets-1 isoform X1
9	246437.XP_006158876.1	0.637	Nuclear respiratory factor 1
10	246437.XP_006155282.1	0.623	ETS translocation variant 3
11	246437.XP_006153240.1	0.607	Nuclear receptor corepressor 1
12	246437.XP_006161587.1	0.607	Interleukin enhancer-binding factor 3 isoform X1
13	246437.XP_006158115.1	0.596	RING1 and YY1-binding protein-like
14	246437.XP_006143780.1	0.581	Tudor domain-containing protein 7
15	246437.XP_006171765.1	0.581	ETS translocation variant 2
16	246437.XP_006159320.1	0.565	ETS domain-containing protein Elk-4
17	246437.XP_006154990.1	0.564	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
18	246437.XP_006146352.1	0.560	ETS proto-oncogene 2, transcription factor
19	246437.XP_006167461.1	0.556	ETS translocation variant 4
20	246437.XP_006166373.1	0.552	Twinkle protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.988	DNA binding
GO:0043565	0.984	sequence-specific DNA binding
GO:0003690	0.983	double-stranded DNA binding
GO:0000976	0.966	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.978	cellular process
GO:0019222	0.968	regulation of metabolic process
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0048518	0.951	positive regulation of biological process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0048522	0.928	positive regulation of cellular process
GO:0010604	0.911	positive regulation of macromolecule metabolic process
GO:0051173	0.905	positive regulation of nitrogen compound metabolic process
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0045935	0.900	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.831	positive regulation of macromolecule biosynthetic process
GO:0031328	0.828	positive regulation of cellular biosynthetic process
GO:0006357	0.827	regulation of transcription by RNA polymerase II
GO:0045893	0.786	positive regulation of DNA-templated transcription
GO:0045944	0.741	positive regulation of transcription by RNA polymerase II
GO:0071840	0.548	cellular component organization or biogenesis
GO:0016043	0.473	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0099080	0.990	supramolecular complex
GO:0035770	0.970	ribonucleoprotein granule
GO:0036464	0.901	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]