StarFunc result for job id Q06587

User Input

>input (406 residues)
MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMT
TKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAH
QDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGE
GDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLG
GGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
LRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQ
YTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1U9X8F2	0.702	0.702	4.318E-68	406	1.000	1.000	A0A1U9X8F2.pdb.gz	A0A1U9X8F2_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=1
2	AFDB:Q803I4	0.381	0.456	3.622E-42	336	0.525	0.634	Q803I4.pdb.gz	RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio OX=7955 GN=rnf2 PE=2 SV=1
3	AFDB:Q99496	0.384	0.461	7.187E-41	336	0.527	0.637	Q99496.pdb.gz	RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1
4	AFDB:Q9VB08	0.561	0.526	1.274E-31	435	0.466	0.434	Q9VB08.pdb.gz	RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster OX=7227 GN=Sce PE=1 SV=1
5	PDB:4r8pL	0.245	0.387	2.613E-16	254	0.234	0.374	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
6	AFDB:F4I2H4	0.255	0.224	6.115E-16	468	0.209	0.182	F4I2H4.pdb.gz	F4I2H4_ARATH RING 1B OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
7	AFDB:F4K8U4	0.194	0.152	2.357E-7	525	0.175	0.135	F4K8U4.pdb.gz	F4K8U4_ARATH RING 1A OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=1
8	AFDB:Q9LS86	0.186	0.159	8.406E-7	480	0.202	0.171	Q9LS86.pdb.gz	DRIPH_ARATH Probable E3 ubiquitin protein ligase DRIPH OS=Arabidopsis thaliana OX=3702 GN=At3g23060 PE=1 SV=1
9	AFDB:H2KYH3	0.191	0.035	3.404E-6	2476	0.158	0.026	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
10	AFDB:Q21610	0.184	0.122	4.389E-6	627	0.133	0.086	Q21610.pdb.gz	Q21610_CAEEL Par-2 protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=2 SV=1
11	PDB:5k1aF	0.179	0.123	3.444E-4	600	0.034	0.023	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
12	PDB:7jzvA	0.164	0.258	4.732E-4	253	0.059	0.095	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
13	PDB:5gm6a	0.149	0.455	6.503E-4	123	0.049	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:5dkaA	0.146	0.588	8.386E-4	96	0.049	0.208	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7qcdC	0.160	0.234	1.486E-3	267	0.052	0.079	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:3plvA	0.171	0.716	1.916E-3	80	0.049	0.250	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	AFDB:P97868	0.169	0.043	2.091E-3	1790	0.145	0.033	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
18	PDB:5lj5t	0.120	0.111	6.017E-3	438	0.034	0.032	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:4rm8A	0.183	0.200	8.268E-3	368	0.030	0.033	4rm8A.pdb.gz
20	PDB:4pyuA	0.161	0.732	9.389E-3	76	0.032	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X8F2	0.0	816	406	1.000	1.000	A0A1U9X8F2_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=1
2	O35730	0.0	787	406	0.966	0.966	RING1_MOUSE E3 ubiquitin-protein ligase RING1 OS=Mus musculus OX=10090 GN=Ring1 PE=1 SV=2
3	Q06587	0.0	816	406	1.000	1.000	RING1_HUMAN E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2
4	Q9CQJ4	5.42e-142	409	336	0.542	0.655	RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus OX=10090 GN=Rnf2 PE=1 SV=1
5	Q99496	6.89e-142	409	336	0.542	0.655	RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1
6	Q803I4	1.17e-139	403	336	0.537	0.649	RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio OX=7955 GN=rnf2 PE=2 SV=1
7	Q4KLY4	6.92e-123	360	308	0.483	0.636	RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus OX=10116 GN=Rnf2 PE=2 SV=1
8	X6RFN3	1.10e-99	298	245	0.392	0.649	X6RFN3_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=2
9	Q9VB08	4.30e-79	252	435	0.283	0.264	RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster OX=7227 GN=Sce PE=1 SV=1
10	Q0WX00	3.10e-22	100	460	0.099	0.087	RNG1B_ARATH Putative E3 ubiquitin-protein ligase RING1b OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
11	Q9FKW0	3.10e-22	100	522	0.099	0.077	RNG1A_ARATH Putative E3 ubiquitin-protein ligase RING1a OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=2
12	F4I2H4	3.17e-22	100	468	0.099	0.085	F4I2H4_ARATH RING 1B OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
13	H2KYH3	7.59e-15	79.3	2476	0.084	0.014	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
14	Q9M9Y4	6.80e-08	56.6	421	0.074	0.071	DRIP1_ARATH E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis thaliana OX=3702 GN=DRIP1 PE=1 SV=2
15	F4K8U4	1.87e-07	55.5	525	0.076	0.059	F4K8U4_ARATH RING 1A OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=1
16	P35227	3.88e-07	53.9	344	0.079	0.093	PCGF2_HUMAN Polycomb group RING finger protein 2 OS=Homo sapiens OX=9606 GN=PCGF2 PE=1 SV=1
17	P43254	4.71e-07	54.3	675	0.064	0.039	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
18	P35820	5.19e-07	54.3	1601	0.062	0.016	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
19	Q94AY3	8.56e-07	53.1	420	0.074	0.071	DRIP2_ARATH E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis thaliana OX=3702 GN=DRIP2 PE=1 SV=1
20	P38398	8.60e-07	53.9	1863	0.062	0.013	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	8.2e+02	11.3	Prokaryotic RING finger family 4
2	PF16207 RAWUL	4.7e-26	102.5	RAWUL domain RING finger- and WD40-associated ubiquitin-like
3	PF00097 zf-C3HC4	5e-07	40.8	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	1e-12	58.9	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.00063	30.9	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	0.57	21.7	zinc finger of C3HC4-type, RING
7	PF17121 zf-C3HC4_5	3.6e+02	12.5	Zinc finger, C3HC4 type (RING finger)
8	PF11789 zf-Nse	0.55	21.5	Zinc-finger of the MIZ type in Nse subunit
9	PF12678 zf-rbx1	6.7	18.4	RING-H2 zinc finger domain
10	PF13639 zf-RING_2	3.6e-05	35.3	Ring finger domain
11	PF14570 zf-RING_4	1.5	19.9	RING/Ubox like zinc-binding domain
12	PF14634 zf-RING_5	0.26	22.6	zinc-RING finger domain
13	PF14835 zf-RING_6	0.91	20.8	zf-RING of BARD1-type protein
14	PF13445 zf-RING_UBOX	0.039	25.3	RING-type zinc-finger
15	PF14569 zf-UDP	3.1e+02	12.9	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233630	0.999	Polycomb group RING finger protein 1
2	9606.ENSP00000269385	0.999	Chromobox protein homolog 8
3	9606.ENSP00000365851	0.999	Polycomb complex protein BMI-1
4	9606.ENSP00000419494	0.999	RING1 and YY1-binding protein
5	9606.ENSP00000257118	0.998	Polyhomeotic-like protein 2
6	9606.ENSP00000328004	0.998	YY1 associated factor 2, isoform CRA_d
7	9606.ENSP00000358862	0.998	Polycomb group RING finger protein 6
8	9606.ENSP00000216133	0.997	Chromobox protein homolog 7
9	9606.ENSP00000269397	0.997	E3 SUMO-protein ligase CBX4
10	9606.ENSP00000384490	0.997	Chromobox protein homolog 6
11	9606.ENSP00000440674	0.997	Polyhomeotic-like protein 1
12	9606.ENSP00000445704	0.997	Polycomb group RING finger protein 5
13	9606.ENSP00000354724	0.996	Polycomb group RING finger protein 3
14	9606.ENSP00000308750	0.995	Chromobox protein homolog 2
15	9606.ENSP00000482063	0.994	Polycomb group RING finger protein 2
16	9606.ENSP00000420294	0.993	Polyhomeotic-like protein 3
17	9606.ENSP00000356480	0.988	E3 ubiquitin-protein ligase RING2
18	9606.ENSP00000473391	0.985	annotation not available
19	9606.ENSP00000263360	0.983	Polycomb protein EED
20	9606.ENSP00000316578	0.981	Polycomb protein SUZ12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019787	0.956	ubiquitin-like protein transferase activity
GO:0004842	0.946	ubiquitin-protein transferase activity
GO:0003682	0.774	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:1903507	0.995	negative regulation of nucleic acid-templated transcription
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0045892	0.981	negative regulation of DNA-templated transcription
GO:0009987	0.975	cellular process
GO:0071704	0.857	organic substance metabolic process
GO:0044238	0.842	primary metabolic process
GO:0006807	0.836	nitrogen compound metabolic process
GO:0043170	0.823	macromolecule metabolic process
GO:1901564	0.786	organonitrogen compound metabolic process
GO:0019538	0.721	protein metabolic process
GO:0043412	0.691	macromolecule modification
GO:0036211	0.681	protein modification process
GO:0032446	0.668	protein modification by small protein conjugation
GO:0016567	0.654	protein ubiquitination
GO:0071840	0.544	cellular component organization or biogenesis
GO:0016043	0.497	cellular component organization
GO:0032502	0.418	developmental process
GO:0006325	0.411	chromatin organization
GO:0032501	0.391	multicellular organismal process
GO:0048856	0.390	anatomical structure development
GO:0007275	0.365	multicellular organism development
GO:0006338	0.349	chromatin remodeling
GO:0006357	0.342	regulation of transcription by RNA polymerase II
GO:0016570	0.325	histone modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0000151	0.997	ubiquitin ligase complex
GO:0031519	0.990	PcG protein complex
GO:0005829	0.970	cytosol
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0005694	0.792	chromosome
GO:0016604	0.676	nuclear body
GO:0035102	0.600	PRC1 complex
GO:0000785	0.556	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.956	Transferases.

[back to server]