StarFunc result for job id Q06643

User Input

>input (244 residues)
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETAD
PGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFS
DAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06643	1.000	1.000	8.702E-44	244	1.000	1.000	Q06643.pdb.gz	TNFC_HUMAN Lymphotoxin-beta OS=Homo sapiens OX=9606 GN=LTB PE=1 SV=1
2	AFDB:P41155	0.642	0.515	1.745E-30	306	0.762	0.608	P41155.pdb.gz	TNFC_MOUSE Lymphotoxin-beta OS=Mus musculus OX=10090 GN=Ltb PE=2 SV=1
3	AFDB:P01374	0.546	0.645	5.665E-14	205	0.221	0.263	P01374.pdb.gz	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
4	AFDB:B3GDZ6	0.532	0.558	5.977E-14	232	0.225	0.237	B3GDZ6.pdb.gz	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
5	AFDB:Q8K3Y7	0.545	0.528	1.077E-13	252	0.238	0.230	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
6	AFDB:Q1JQ40	0.557	0.561	1.744E-13	242	0.217	0.219	Q1JQ40.pdb.gz
7	AFDB:P06804	0.551	0.571	2.161E-13	235	0.221	0.230	P06804.pdb.gz	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
8	AFDB:Q08CQ3	0.550	0.572	3.316E-13	234	0.201	0.209	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
9	AFDB:O95150	0.555	0.540	5.665E-13	251	0.258	0.251	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
10	AFDB:P01375	0.543	0.567	6.305E-13	233	0.234	0.245	P01375.pdb.gz	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
11	PDB:7e57B	0.324	0.595	4.219E-5	123	0.078	0.154	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:5h4bA	0.375	0.635	3.228E-4	136	0.090	0.162	5h4bA.pdb.gz
13	PDB:5kc6B	0.352	0.557	1.446E-3	144	0.086	0.146	5kc6B.pdb.gz
14	PDB:7drtB	0.204	0.121	4.953E-2	496	0.074	0.036	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
15	PDB:6xwvD	0.162	0.266	7.602E-2	123	0.078	0.154	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
16	PDB:5jovA	0.107	0.044	1.167E-1	949	0.078	0.020	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
17	PDB:3rjrC	0.177	0.143	1.231E-1	343	0.139	0.099	3rjrC.pdb.gz
18	PDB:6xwuA	0.164	0.245	1.525E-1	138	0.057	0.101	6xwuA.pdb.gz
19	PDB:5nxsA	0.181	0.160	1.993E-1	290	0.107	0.090	5nxsA.pdb.gz
20	PDB:6umxA	0.231	0.210	1.993E-1	279	0.078	0.068	6umxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q06643	1.85e-171	473	244	1.000	1.000	TNFC_HUMAN Lymphotoxin-beta OS=Homo sapiens OX=9606 GN=LTB PE=1 SV=1
2	P41155	2.95e-89	268	306	0.553	0.441	TNFC_MOUSE Lymphotoxin-beta OS=Mus musculus OX=10090 GN=Ltb PE=2 SV=1
3	Q6MG45	8.43e-87	261	306	0.549	0.438	Q6MG45_RAT Lymphotoxin-beta OS=Rattus norvegicus OX=10116 GN=Ltb PE=2 SV=1
4	P01375	3.08e-13	68.9	233	0.172	0.180	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
5	C1K3N5	3.46e-13	68.9	232	0.172	0.181	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
6	B3GDZ6	9.02e-13	67.8	232	0.184	0.194	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
7	P23563	9.02e-13	67.8	232	0.184	0.194	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
8	P41047	1.92e-11	64.7	279	0.205	0.179	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
9	Q8K3Y7	1.18e-10	62.0	252	0.234	0.226	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
10	P06804	2.84e-10	60.8	235	0.176	0.183	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
11	Q06599	3.99e-10	60.5	234	0.168	0.175	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
12	P36940	1.93e-09	58.9	278	0.189	0.165	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
13	P09225	2.18e-09	57.8	202	0.193	0.233	TNFB_MOUSE Lymphotoxin-alpha OS=Mus musculus OX=10090 GN=Lta PE=2 SV=1
14	Q06332	2.84e-09	57.4	202	0.193	0.233	TNFB_RAT Lymphotoxin-alpha OS=Rattus norvegicus OX=10116 GN=Lta PE=3 SV=1
15	O43557	1.84e-08	55.5	240	0.234	0.237	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
16	P01374	2.12e-08	55.1	205	0.221	0.263	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
17	Q6FG55	2.14e-08	55.1	205	0.221	0.263	Q6FG55_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=1
18	P16599	2.16e-08	55.5	235	0.168	0.174	TNFA_RAT Tumor necrosis factor OS=Rattus norvegicus OX=10116 GN=Tnf PE=2 SV=1
19	O95150	1.03e-07	53.5	251	0.176	0.171	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
20	Q08CQ3	1.14e-07	53.1	234	0.168	0.175	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	2.9e-31	119.4	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228918	0.995	Tumor necrosis factor receptor superfamily member 3
2	9606.ENSP00000403495	0.994	Lymphotoxin-alpha
3	9606.ENSP00000359663	0.854	CD40 ligand
4	9606.ENSP00000365048	0.847	Tumor necrosis factor ligand superfamily member 13B
5	9606.ENSP00000365435	0.780	Tumor necrosis factor receptor superfamily member 1B
6	9606.ENSP00000398698	0.771	Tumor necrosis factor
7	9606.ENSP00000361359	0.766	Tumor necrosis factor receptor superfamily member 5
8	9606.ENSP00000381775	0.758	Tumor necrosis factor ligand superfamily member 11
9	9606.ENSP00000365261	0.754	Leukocyte-specific transcript 1 protein
10	9606.ENSP00000465500	0.750	Tumor necrosis factor receptor superfamily member 11A
11	9606.ENSP00000162749	0.743	Tumor necrosis factor receptor superfamily member 1A
12	9606.ENSP00000482657	0.737	Mitogen-activated protein kinase kinase kinase 14
13	9606.ENSP00000221452	0.734	Transcription factor RelB
14	9606.ENSP00000293825	0.732	Tumor necrosis factor ligand superfamily member 12
15	9606.ENSP00000469049	0.732	Tumor necrosis factor ligand superfamily member 14
16	9606.ENSP00000291232	0.719	Tumor necrosis factor receptor superfamily member 13C
17	9606.ENSP00000263464	0.716	Baculoviral IAP repeat-containing protein 3
18	9606.ENSP00000454207	0.712	TNF receptor-associated factor 3
19	9606.ENSP00000247668	0.661	TNF receptor-associated factor 2
20	9606.ENSP00000477613	0.653	Baculoviral IAP repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0098772	0.508	molecular function regulator activity
GO:0140677	0.494	molecular function activator activity
GO:0005126	0.402	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050896	0.996	response to stimulus
GO:0007165	0.989	signal transduction
GO:0007267	0.898	cell-cell signaling
GO:0048518	0.810	positive regulation of biological process
GO:0048522	0.726	positive regulation of cellular process
GO:0019222	0.564	regulation of metabolic process
GO:0002376	0.495	immune system process
GO:0060255	0.464	regulation of macromolecule metabolic process
GO:0006955	0.449	immune response
GO:0048583	0.374	regulation of response to stimulus
GO:0010604	0.335	positive regulation of macromolecule metabolic process
GO:0051239	0.326	regulation of multicellular organismal process
GO:0010468	0.323	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043231	0.375	intracellular membrane-bounded organelle
GO:0005737	0.328	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]