StarFunc result for job id Q06710

User Input

>input (450 residues)
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51974	0.483	0.476	6.891E-57	457	0.980	0.965	P51974.pdb.gz	PAX8_RAT Paired box protein Pax-8 OS=Rattus norvegicus OX=10116 GN=Pax8 PE=1 SV=2
2	AFDB:Q9PUK5	0.364	0.353	1.072E-44	465	0.747	0.723	Q9PUK5.pdb.gz	PAX8_XENLA Paired box protein Pax-8 OS=Xenopus laevis OX=8355 GN=pax8 PE=2 SV=1
3	AFDB:A0A024R524	0.333	0.375	1.021E-41	398	0.720	0.814	A0A024R524.pdb.gz
4	AFDB:W0S3W1	0.348	0.342	1.021E-41	458	0.704	0.692	W0S3W1.pdb.gz	W0S3W1_ONCMY Transcription factor Pax8a OS=Oncorhynchus mykiss OX=8022 GN=Pax8a PE=2 SV=1
5	AFDB:F1Q9Q9	0.365	0.367	4.211E-40	448	0.671	0.674	F1Q9Q9.pdb.gz	F1Q9Q9_DANRE Paired box 8 OS=Danio rerio OX=7955 GN=pax8 PE=4 SV=2
6	AFDB:A0A024R4X8	0.327	0.448	1.817E-36	321	0.600	0.841	A0A024R4X8.pdb.gz
7	AFDB:O57682	0.324	0.297	2.693E-34	494	0.616	0.561	O57682.pdb.gz	PAX2B_XENLA Paired box protein Pax-2-B OS=Xenopus laevis OX=8355 GN=pax2-b PE=2 SV=2
8	AFDB:F1R139	0.339	0.390	1.072E-31	386	0.542	0.632	F1R139.pdb.gz
9	AFDB:Q90268	0.316	0.345	2.031E-31	410	0.533	0.585	Q90268.pdb.gz	PAX2A_DANRE Paired box protein Pax-2a OS=Danio rerio OX=7955 GN=pax2a PE=2 SV=2
10	AFDB:Q02962	0.332	0.356	7.734E-31	417	0.524	0.566	Q02962.pdb.gz	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
11	PDB:2avuE	0.096	0.205	1.016E-1	156	0.042	0.122	2avuE.pdb.gz	Structure of the Escherichia coli FlhDC Complex, a Prokaryotic Heteromeric Regulator of Transcription.
12	PDB:7pikC	0.137	0.117	5.484E-1	557	0.038	0.031	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
13	PDB:5khrN	0.106	0.076	6.528E-1	645	0.024	0.017	5khrN.pdb.gz
14	PDB:5lzbz	0.092	0.071	6.919E-1	614	0.047	0.034	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
15	PDB:2cg4A	0.093	0.263	7.772E-1	149	0.040	0.121	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:2rvqC	0.066	0.160	1.039	133	0.058	0.195	2rvqC.pdb.gz
17	PDB:2vbwA	0.087	0.233	1.237	147	0.029	0.088	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
18	PDB:7asvA	0.094	0.232	1.237	155	0.027	0.077	7asvA.pdb.gz
19	PDB:2gqqC	0.092	0.240	1.311	157	0.031	0.089	2gqqC.pdb.gz
20	PDB:4v6wAN	0.086	0.204	1.311	150	0.071	0.213	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q9Q9	0.0	556	448	0.669	0.672	F1Q9Q9_DANRE Paired box 8 OS=Danio rerio OX=7955 GN=pax8 PE=4 SV=2
2	P51974	0.0	891	457	0.980	0.965	PAX8_RAT Paired box protein Pax-8 OS=Rattus norvegicus OX=10116 GN=Pax8 PE=1 SV=2
3	Q00288	0.0	891	457	0.982	0.967	PAX8_MOUSE Paired box protein Pax-8 OS=Mus musculus OX=10090 GN=Pax8 PE=1 SV=3
4	Q06710	0.0	916	450	1.000	1.000	PAX8_HUMAN Paired box protein Pax-8 OS=Homo sapiens OX=9606 GN=PAX8 PE=1 SV=2
5	Q9PUK5	0.0	643	465	0.747	0.723	PAX8_XENLA Paired box protein Pax-8 OS=Xenopus laevis OX=8355 GN=pax8 PE=2 SV=1
6	R9W7C9	0.0	916	450	1.000	1.000	R9W7C9_HUMAN Paired box 8 isoform 1 OS=Homo sapiens OX=9606 GN=PAX8 PE=2 SV=1
7	W0S3W1	0.0	612	458	0.700	0.688	W0S3W1_ONCMY Transcription factor Pax8a OS=Oncorhynchus mykiss OX=8022 GN=Pax8a PE=2 SV=1
8	O57682	3.05e-178	509	494	0.622	0.567	PAX2B_XENLA Paired box protein Pax-2-B OS=Xenopus laevis OX=8355 GN=pax2-b PE=2 SV=2
9	Q9PTX1	1.13e-160	461	394	0.560	0.640	Q9PTX1_CHICK Paired-box containing protein Pax-2 OS=Gallus gallus OX=9031 GN=Pax-2 PE=2 SV=1
10	A0A0G2JZ47	7.50e-152	438	394	0.524	0.599	A0A0G2JZ47_RAT Paired box 2 OS=Rattus norvegicus OX=10116 GN=Pax2 PE=4 SV=2
11	A0A0A0MRH7	4.02e-151	436	393	0.522	0.598	A0A0A0MRH7_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=1
12	P32114	3.33e-149	432	414	0.540	0.587	PAX2_MOUSE Paired box protein Pax-2 OS=Mus musculus OX=10090 GN=Pax2 PE=1 SV=2
13	Q02962	3.19e-148	430	417	0.531	0.573	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
14	W0S4A0	4.13e-148	425	303	0.471	0.700	W0S4A0_ONCMY Transcription factor Pax8b OS=Oncorhynchus mykiss OX=8022 GN=Pax8b PE=2 SV=1
15	D4ACZ2	5.21e-146	424	416	0.524	0.567	D4ACZ2_RAT Paired box 2 OS=Rattus norvegicus OX=10116 GN=Pax2 PE=4 SV=1
16	Q5SZP1	7.98e-146	424	409	0.507	0.557	Q5SZP1_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
17	Q02650	2.24e-140	409	391	0.507	0.583	PAX5_MOUSE Paired box protein Pax-5 OS=Mus musculus OX=10090 GN=Pax5 PE=1 SV=1
18	Q02548	5.05e-139	405	391	0.502	0.578	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
19	G3V5S4	1.02e-123	363	304	0.427	0.632	G3V5S4_HUMAN Paired box 2 (Fragment) OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
20	O93370	1.18e-120	358	386	0.424	0.495	O93370_DANRE Paired box 2b OS=Danio rerio OX=7955 GN=Pax2.2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13384 HTH_23	0.016	26.3	Homeodomain-like domain
2	PF13518 HTH_28	6.2e+02	11.9	Helix-turn-helix domain
3	PF13565 HTH_32	0.35	22.8	Homeodomain-like domain
4	PF13936 HTH_38	3.2e+02	12.5	Helix-turn-helix domain
5	PF12759 HTH_Tnp_IS1	3.3e+02	12.3	InsA C-terminal domain
6	PF00292 PAX	1.8e-69	242.9	'Paired box' domain
7	PF12403 Pax2_C	8.1e-47	169.3	Paired-box protein 2 C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263334

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.938	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000346879	0.927	Homeobox protein Nkx-2.1
3	9606.ENSP00000332973	0.902	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000305355	0.877	Protein kinase C beta type
5	9606.ENSP00000220616	0.837	Thyroglobulin
6	9606.ENSP00000329243	0.828	Keratin, type II cytoskeletal 7
7	9606.ENSP00000364265	0.826	Forkhead box protein E1
8	9606.ENSP00000419692	0.818	Retinoic acid receptor RXR-alpha
9	9606.ENSP00000352900	0.816	Retinoic acid receptor RXR-gamma
10	9606.ENSP00000309591	0.810	cAMP-dependent protein kinase catalytic subunit alpha
11	9606.ENSP00000359719	0.810	cAMP-dependent protein kinase catalytic subunit beta
12	9606.ENSP00000363817	0.810	Retinoic acid receptor RXR-beta
13	9606.ENSP00000366488	0.810	cAMP-dependent protein kinase catalytic subunit gamma
14	9606.ENSP00000408695	0.803	Protein kinase C alpha type
15	9606.ENSP00000263431	0.800	Protein kinase C gamma type
16	9606.ENSP00000441235	0.794	Thyrotropin receptor
17	9606.ENSP00000467579	0.774	WW domain-binding protein 2
18	9606.ENSP00000331327	0.756	Wilms tumor protein
19	9606.ENSP00000347942	0.755	Proto-oncogene tyrosine-protein kinase receptor Ret
20	9606.ENSP00000342626	0.734	Eyes absent homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0005515	0.998	protein binding
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.934	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.919	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.446	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.331	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0048856	0.977	anatomical structure development
GO:0048518	0.976	positive regulation of biological process
GO:0019222	0.976	regulation of metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0009889	0.971	regulation of biosynthetic process
GO:0032501	0.968	multicellular organismal process
GO:0007275	0.928	multicellular organism development
GO:0048522	0.928	positive regulation of cellular process
GO:0009653	0.927	anatomical structure morphogenesis
GO:0080090	0.925	regulation of primary metabolic process
GO:0010556	0.920	regulation of macromolecule biosynthetic process
GO:0031326	0.919	regulation of cellular biosynthetic process
GO:0048731	0.907	system development
GO:0045893	0.899	positive regulation of DNA-templated transcription
GO:0060993	0.864	kidney morphogenesis
GO:0072006	0.841	nephron development
GO:0050896	0.812	response to stimulus
GO:0006357	0.794	regulation of transcription by RNA polymerase II
GO:0072073	0.788	kidney epithelium development
GO:0061326	0.753	renal tubule development
GO:0043583	0.727	ear development
GO:0044237	0.703	cellular metabolic process
GO:0072009	0.625	nephron epithelium development
GO:0072028	0.595	nephron morphogenesis
GO:0001823	0.557	mesonephros development
GO:0051716	0.543	cellular response to stimulus
GO:0035239	0.542	tube morphogenesis
GO:0061333	0.529	renal tubule morphogenesis
GO:0071704	0.476	organic substance metabolic process
GO:0045944	0.447	positive regulation of transcription by RNA polymerase II
GO:0048519	0.445	negative regulation of biological process
GO:0048869	0.420	cellular developmental process
GO:0030154	0.401	cell differentiation
GO:0048523	0.394	negative regulation of cellular process
GO:0072080	0.388	nephron tubule development
GO:0042221	0.375	response to chemical
GO:0048839	0.372	inner ear development
GO:0006807	0.371	nitrogen compound metabolic process
GO:0048646	0.357	anatomical structure formation involved in morphogenesis
GO:0044238	0.353	primary metabolic process
GO:0072088	0.327	nephron epithelium morphogenesis
GO:0072078	0.319	nephron tubule morphogenesis
GO:0072164	0.317	mesonephric tubule development
GO:0001656	0.304	metanephros development
GO:0007399	0.302	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.330	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]