StarFunc result for job id Q06945

User Input

>input (474 residues)
MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIK
RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHM
ADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGG
GGGASGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAASFAAE
QAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLFG
GLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPAAGRSPADHRG
YASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG
SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06945	0.999	0.999	1.317E-58	474	1.000	1.000	Q06945.pdb.gz	SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens OX=9606 GN=SOX4 PE=1 SV=1
2	AFDB:Q06831	0.266	0.285	2.354E-44	440	0.816	0.880	Q06831.pdb.gz	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
3	AFDB:Q9U1H0	0.173	0.051	9.878E-5	1832	0.190	0.049	Q9U1H0.pdb.gz	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
4	AFDB:Q8IMA8	0.153	0.066	1.738E-4	1192	0.217	0.086	Q8IMA8.pdb.gz	PANG2_DROME Protein pangolin, isoform J OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=2
5	AFDB:F1Q6M9	0.163	0.035	1.970E-4	2623	0.171	0.031	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
6	PDB:1j5nA	0.133	0.616	6.012E-3	93	0.044	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
7	AFDB:Q580H3	0.071	0.057	1.344E-1	601	0.146	0.115	Q580H3.pdb.gz	Q580H3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.140 PE=4 SV=1
8	AFDB:E1JJ76	0.056	0.026	2.855E-1	1165	0.171	0.070	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
9	AFDB:Q9FWQ5	0.072	0.026	3.907E-1	1706	0.158	0.044	Q9FWQ5.pdb.gz	HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis thaliana OX=3702 GN=HAC12 PE=3 SV=2
10	AFDB:A8JQU7	0.058	0.032	4.160E-1	1165	0.181	0.074	A8JQU7.pdb.gz	A8JQU7_DROME Alhambra, isoform F OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
11	AFDB:Q9QWH1	0.079	0.049	6.061E-1	850	0.150	0.084	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
12	PDB:2cyyA	0.056	0.146	1.170	151	0.030	0.093	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
13	PDB:7ploI	0.097	0.101	1.170	451	0.023	0.024	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:5b63C	0.063	0.055	1.933	553	0.023	0.020	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
15	PDB:7cpuSN	0.068	0.158	2.191	150	0.025	0.080	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
16	PDB:7fbyA	0.057	0.151	2.333	153	0.017	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:2gqqC	0.050	0.124	5.616	157	0.021	0.064	2gqqC.pdb.gz
18	PDB:4ywtA	0.064	0.072	5.616	411	0.023	0.027	4ywtA.pdb.gz	Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
19	PDB:6zm7CE	0.078	0.288	5.979	124	0.017	0.065	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
20	PDB:7n9sA	0.063	0.018	5.979	2365	0.013	0.003	7n9sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQY6	0.0	544	440	0.772	0.832	A0A8I5ZQY6_RAT Transcription factor SOX OS=Rattus norvegicus OX=10116 GN=Sox4 PE=4 SV=1
2	Q06831	0.0	543	440	0.772	0.832	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
3	Q06945	0.0	927	474	1.000	1.000	SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens OX=9606 GN=SOX4 PE=1 SV=1
4	Q9DG48	7.64e-138	403	379	0.570	0.712	Q9DG48_XENLA Transcription factor SOX OS=Xenopus laevis OX=8355 GN=Sox4 PE=2 SV=1
5	Q6P0Z4	2.59e-70	229	363	0.243	0.317	Q6P0Z4_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=sox4 PE=2 SV=2
6	Q6P2A2	5.74e-67	220	342	0.241	0.333	Q6P2A2_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=zgc:63851 PE=2 SV=1
7	P48435	4.50e-57	196	396	0.205	0.245	SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus OX=9031 GN=SOX11 PE=2 SV=1
8	Q91731	1.55e-56	194	382	0.198	0.246	SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis OX=8355 GN=sox11-a PE=1 SV=2
9	Q7M6Y2	1.67e-56	194	395	0.203	0.243	SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus OX=10090 GN=Sox11 PE=1 SV=1
10	P0C1G9	1.70e-56	194	395	0.203	0.243	SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1
11	P35716	2.52e-56	195	441	0.203	0.218	SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens OX=9606 GN=SOX11 PE=1 SV=2
12	P40650	1.45e-55	191	374	0.177	0.225	SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis OX=8355 GN=sox11-b PE=1 SV=2
13	Q04890	1.51e-52	181	314	0.167	0.252	SOX12_MOUSE Transcription factor SOX-12 OS=Mus musculus OX=10090 GN=Sox12 PE=1 SV=2
14	O15370	3.69e-52	180	315	0.165	0.248	SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens OX=9606 GN=SOX12 PE=2 SV=2
15	Q9I9C7	1.38e-51	180	368	0.179	0.231	Q9I9C7_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=fc90d10 PE=2 SV=1
16	O57399	7.18e-51	178	367	0.181	0.234	O57399_ONCMY Transcription factor SOX OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00079394001 PE=2 SV=1
17	Q9I9C8	1.18e-50	177	354	0.173	0.232	Q9I9C8_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=cb237 PE=2 SV=1
18	Q8AXQ4	5.83e-49	170	244	0.154	0.299	SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis OX=8355 GN=sox12 PE=2 SV=1
19	P43267	1.31e-35	134	231	0.137	0.281	SOX15_MOUSE Protein SOX-15 OS=Mus musculus OX=10090 GN=Sox15 PE=1 SV=3
20	P40656	3.50e-35	140	669	0.186	0.132	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	4.9e-23	92.6	HMG (high mobility group) box
2	PF09011 HMG_box_2	5.2e-05	35.1	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.955	Catenin beta-1
2	9606.ENSP00000259915	0.942	POU domain, class 5, transcription factor 1
3	9606.ENSP00000320147	0.908	Histone-lysine N-methyltransferase EZH2
4	9606.ENSP00000260130	0.888	Syntenin-1
5	9606.ENSP00000340347	0.836	Transcription factor 7
6	9606.ENSP00000265165	0.835	Lymphoid enhancer-binding factor 1
7	9606.ENSP00000348056	0.748	SUMO-conjugating enzyme UBC9
8	9606.ENSP00000412209	0.720	Interleukin-5 receptor subunit alpha
9	9606.ENSP00000269305	0.710	Cellular tumor antigen p53
10	9606.ENSP00000366915	0.706	Krueppel-like factor 5
11	9606.ENSP00000341551	0.700	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000358404	0.690	Transcription factor 7-like 2
13	9606.ENSP00000282111	0.681	Transcription factor 7-like 1
14	9606.ENSP00000430919	0.664	Canonical high mobility group
15	9606.ENSP00000479618	0.660	Myc proto-oncogene protein
16	9606.ENSP00000377508	0.654	Junction plakoglobin
17	9606.ENSP00000263253	0.626	Histone acetyltransferase p300
18	9606.ENSP00000339958	0.609	Nischarin
19	9606.ENSP00000362613	0.597	Homeobox protein CDX-4
20	9606.ENSP00000368632	0.596	Trans-acting T-cell-specific transcription factor GATA-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.986	negative regulation of biological process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0010556	0.979	regulation of macromolecule biosynthetic process
GO:0048518	0.978	positive regulation of biological process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0048523	0.972	negative regulation of cellular process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.961	regulation of DNA-templated transcription
GO:0009893	0.928	positive regulation of metabolic process
GO:0048522	0.923	positive regulation of cellular process
GO:0010604	0.914	positive regulation of macromolecule metabolic process
GO:0006357	0.897	regulation of transcription by RNA polymerase II
GO:0009966	0.886	regulation of signal transduction
GO:0009987	0.881	cellular process
GO:0031325	0.875	positive regulation of cellular metabolic process
GO:0051254	0.867	positive regulation of RNA metabolic process
GO:0050896	0.864	response to stimulus
GO:0045893	0.861	positive regulation of DNA-templated transcription
GO:0009892	0.858	negative regulation of metabolic process
GO:0010605	0.838	negative regulation of macromolecule metabolic process
GO:0045944	0.804	positive regulation of transcription by RNA polymerase II
GO:0032502	0.783	developmental process
GO:0051172	0.774	negative regulation of nitrogen compound metabolic process
GO:0032501	0.743	multicellular organismal process
GO:0048856	0.705	anatomical structure development
GO:0050793	0.671	regulation of developmental process
GO:0042127	0.643	regulation of cell population proliferation
GO:0007275	0.634	multicellular organism development
GO:0048731	0.552	system development
GO:0031324	0.515	negative regulation of cellular metabolic process
GO:0045595	0.496	regulation of cell differentiation
GO:0048513	0.492	animal organ development
GO:0008284	0.436	positive regulation of cell population proliferation
GO:0051094	0.419	positive regulation of developmental process
GO:0051716	0.409	cellular response to stimulus
GO:0051239	0.397	regulation of multicellular organismal process
GO:0010941	0.391	regulation of cell death
GO:1902531	0.390	regulation of intracellular signal transduction
GO:0051246	0.365	regulation of protein metabolic process
GO:0043067	0.362	regulation of programmed cell death
GO:0045892	0.355	negative regulation of DNA-templated transcription
GO:0042981	0.353	regulation of apoptotic process
GO:0030154	0.325	cell differentiation
GO:0000122	0.318	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005739	0.647	mitochondrion
GO:0032991	0.473	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]