StarFunc result for job id Q07021

User Input

>input (282 residues)
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLR
PRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKL
VRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKK
ALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLM
DFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07021	1.000	1.000	8.992E-52	282	1.000	1.000	Q07021.pdb.gz	C1QBP_HUMAN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1
2	AFDB:O35796	0.793	0.801	1.222E-44	279	0.862	0.871	O35796.pdb.gz	C1QBP_RAT Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=C1qbp PE=1 SV=2
3	AFDB:Q3T0B6	0.838	0.849	1.644E-43	278	0.844	0.856	Q3T0B6.pdb.gz	C1QBP_BOVIN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Bos taurus OX=9913 GN=C1QBP PE=2 SV=1
4	AFDB:Q7JXC4	0.633	0.674	2.158E-21	263	0.323	0.346	Q7JXC4.pdb.gz	Q7JXC4_DROME CG6459 protein OS=Drosophila melanogaster OX=7227 GN=P32 PE=1 SV=1
5	AFDB:Q21018	0.612	0.726	5.938E-16	236	0.202	0.242	Q21018.pdb.gz	CRI3_CAEEL Conserved regulator of innate immunity protein 3 OS=Caenorhabditis elegans OX=6239 GN=cri-3 PE=1 SV=2
6	AFDB:O94675	0.517	0.539	1.627E-13	269	0.216	0.227	O94675.pdb.gz	MAM33_SCHPO Mitochondrial acidic protein mam33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC776.07 PE=3 SV=1
7	AFDB:Q9LZM6	0.486	0.511	8.018E-13	267	0.255	0.270	Q9LZM6.pdb.gz	Q9LZM6_ARATH At5g02050 OS=Arabidopsis thaliana OX=3702 GN=At5g02050 PE=1 SV=1
8	AFDB:G5EB23	0.489	0.458	9.572E-13	303	0.227	0.211	G5EB23.pdb.gz	G5EB23_EMENI Regulatory protein SUAPRGA1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03034 PE=4 SV=1
9	AFDB:Q8W487	0.560	0.625	8.043E-11	250	0.191	0.216	Q8W487.pdb.gz	YB95_ARATH Uncharacterized protein At2g39795, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g39795 PE=1 SV=1
10	AFDB:Q386E5	0.335	0.219	4.772E-5	457	0.184	0.114	Q386E5.pdb.gz	Q386E5_TRYB2 Mitochondrial glycoprotein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1150 PE=4 SV=1
11	PDB:2r55A	0.112	0.139	6.740E-2	208	0.071	0.096	2r55A.pdb.gz
12	PDB:2xe4A	0.135	0.070	6.740E-2	721	0.099	0.039	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
13	PDB:7mq8LU	0.097	0.074	7.150E-2	445	0.099	0.063	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6serA	0.117	0.128	1.291E-1	245	0.099	0.114	6serA.pdb.gz
15	PDB:1tlbA	0.148	0.135	1.541E-1	326	0.099	0.086	1tlbA.pdb.gz
16	PDB:3tgoD	0.100	0.135	1.635E-1	186	0.085	0.129	3tgoD.pdb.gz
17	PDB:7o4iB	0.060	0.025	2.071E-1	1180	0.082	0.019	7o4iB.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
18	PDB:6e8eA	0.103	0.073	2.623E-1	468	0.053	0.032	6e8eA.pdb.gz
19	PDB:1iznA	0.086	0.085	3.525E-1	275	0.064	0.065	1iznA.pdb.gz
20	PDB:3g65C	0.102	0.110	3.739E-1	258	0.046	0.050	3g65C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35796	0.0	502	279	0.858	0.867	C1QBP_RAT Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=C1qbp PE=1 SV=2
2	Q07021	0.0	582	282	1.000	1.000	C1QBP_HUMAN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1
3	Q9MZE0	0.0	531	282	0.954	0.954	C1QBP_CHLAE Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Chlorocebus aethiops OX=9534 GN=C1QBP PE=1 SV=2
4	O35658	4.14e-178	493	278	0.851	0.863	C1QBP_MOUSE Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Mus musculus OX=10090 GN=C1qbp PE=1 SV=1
5	Q3T0B6	8.71e-173	480	278	0.844	0.856	C1QBP_BOVIN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Bos taurus OX=9913 GN=C1QBP PE=2 SV=1
6	I3L3B0	4.84e-129	365	178	0.631	1.000	I3L3B0_HUMAN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1
7	I3L3Q7	2.70e-128	363	177	0.628	1.000	I3L3Q7_HUMAN Complement component 1 Q subcomponent-binding protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1
8	Q7JXC4	6.89e-39	139	263	0.294	0.316	Q7JXC4_DROME CG6459 protein OS=Drosophila melanogaster OX=7227 GN=P32 PE=1 SV=1
9	Q21018	6.03e-10	60.5	236	0.170	0.203	CRI3_CAEEL Conserved regulator of innate immunity protein 3 OS=Caenorhabditis elegans OX=6239 GN=cri-3 PE=1 SV=2
10	G5EB23	6.30e-05	45.8	303	0.270	0.251	G5EB23_EMENI Regulatory protein SUAPRGA1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03034 PE=4 SV=1
11	O94675	1.86e-04	44.3	269	0.202	0.212	MAM33_SCHPO Mitochondrial acidic protein mam33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC776.07 PE=3 SV=1
12	Q9LZM6	0.95	33.1	267	0.064	0.067	Q9LZM6_ARATH At5g02050 OS=Arabidopsis thaliana OX=3702 GN=At5g02050 PE=1 SV=1
13	O14285	1.3	32.0	164	0.082	0.140	SPC34_SCHPO DASH complex subunit spc34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spc34 PE=1 SV=1
14	P40513	1.3	32.7	266	0.064	0.068	MAM33_YEAST Mitochondrial acidic protein MAM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAM33 PE=1 SV=1
15	A0A178W169	1.9	32.0	242	0.060	0.070	A0A178W169_ARATH Mitochondrial glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At1g80720 PE=1 SV=1
16	F1RRW5	6.0	31.2	1309	0.078	0.017	ACE_PIG Angiotensin-converting enzyme OS=Sus scrofa OX=9823 GN=ACE PE=1 SV=3
17	Q8ILT4	6.0	31.2	2280	0.057	0.007	MCA3_PLAF7 Metacaspase-3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=MCA3 PE=1 SV=1
18	Q8W487	9.4	30.0	250	0.199	0.224	YB95_ARATH Uncharacterized protein At2g39795, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g39795 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02330 MAM33	1.6e-34	131.2	Mitochondrial glycoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265023	0.995	Kininogen-1
2	9606.ENSP00000253496	0.986	Coagulation factor XII
3	9606.ENSP00000252244	0.983	Keratin, type II cytoskeletal 1
4	9606.ENSP00000418915	0.975	Cyclin-dependent kinase inhibitor 2A
5	9606.ENSP00000401980	0.974	Mitochondrial antiviral-signaling protein
6	9606.ENSP00000315477	0.964	CD209 antigen
7	9606.ENSP00000479488	0.960	Prohibitin
8	9606.ENSP00000226218	0.949	Vitronectin
9	9606.ENSP00000377055	0.947	Lysosomal Pro-X carboxypeptidase
10	9606.ENSP00000221801	0.946	rRNA 2'-O-methyltransferase fibrillarin
11	9606.ENSP00000441875	0.936	Prohibitin-2
12	9606.ENSP00000367830	0.922	Protein kinase C zeta type
13	9606.ENSP00000352833	0.897	Tyrosine-protein phosphatase non-receptor type 22
14	9606.ENSP00000361626	0.897	Nuclease-sensitive element-binding protein 1
15	9606.ENSP00000339883	0.887	Lamin-B receptor
16	9606.ENSP00000322439	0.880	Elongation factor Tu, mitochondrial
17	9606.ENSP00000383949	0.858	NHP2-like protein 1
18	9606.ENSP00000258962	0.852	Serine/arginine-rich splicing factor 1
19	9606.ENSP00000386636	0.838	Lupus La protein
20	9606.ENSP00000308208	0.834	Matrix metalloproteinase-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.997	protein-containing complex binding
GO:0005515	0.997	protein binding
GO:0001848	0.987	complement binding
GO:0001846	0.987	opsonin binding
GO:0001849	0.941	complement component C1q complex binding
GO:0019899	0.558	enzyme binding
GO:0031690	0.407	adrenergic receptor binding
GO:0005080	0.378	protein kinase C binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.968	regulation of biological process
GO:0071840	0.959	cellular component organization or biogenesis
GO:0050896	0.922	response to stimulus
GO:0050794	0.903	regulation of cellular process
GO:0048518	0.881	positive regulation of biological process
GO:0002376	0.833	immune system process
GO:0044085	0.768	cellular component biogenesis
GO:0016043	0.730	cellular component organization
GO:0019222	0.718	regulation of metabolic process
GO:0051171	0.700	regulation of nitrogen compound metabolic process
GO:0060255	0.695	regulation of macromolecule metabolic process
GO:0080090	0.679	regulation of primary metabolic process
GO:0048522	0.673	positive regulation of cellular process
GO:0031323	0.673	regulation of cellular metabolic process
GO:0010468	0.585	regulation of gene expression
GO:0006955	0.558	immune response
GO:0009889	0.546	regulation of biosynthetic process
GO:0031326	0.544	regulation of cellular biosynthetic process
GO:0010556	0.538	regulation of macromolecule biosynthetic process
GO:0006996	0.409	organelle organization
GO:0022607	0.351	cellular component assembly
GO:0008152	0.349	metabolic process
GO:0071704	0.343	organic substance metabolic process
GO:0048519	0.326	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0032991	0.992	protein-containing complex
GO:0005634	0.976	nucleus
GO:0016020	0.960	membrane
GO:0070013	0.956	intracellular organelle lumen
GO:0071944	0.928	cell periphery
GO:0005886	0.916	plasma membrane
GO:0005829	0.837	cytosol
GO:0031981	0.601	nuclear lumen
GO:0005654	0.568	nucleoplasm
GO:0005576	0.339	extracellular region
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]