StarFunc result for job id Q07092

User Input

>input (1604 residues)
MWVSWAPGLWLLGLWATFGHGANTGAQCPPSQQEGLKLEHSSSLPANVTGFNLIHRLSLM
KTSAIKKIRNPKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLF
QVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVA
SVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGKPVSFDLQQVHIYCDPELVLEEGCC
EILPAGCPPETSKARRDTQSNELIEINPQSEGKVYTRCFCLEEPQNSEVDAQLTGRISQK
AERGAKVHQETAADECPPCVHGARDSNVTLAPSGPKGGKGERGLPGPPGSKGEKGARGND
CVRISPDAPLQCAEGPKGEKGESGALGPSGLPGSTGEKGQKGEKGDGGIKGVPGKPGRDG
RPGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKG
SSGIPGKEGPGGKPGKPGVKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPVPAR
GDPGIQGIKGEKGEPCLSCSSVVGAQHLVSSTGASGDVGSPGFGLPGLPGRAGVPGLKGE
KGNFGEAGPAGSPGPPGPVGPAGIKGAKGEPCEPCPALSNLQDGDVRVVALPGPSGEKGE
PGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGTTGRPGLSGEPGVQGPAGPKGEK
GDGCTACPSLQGTVTDMAGRPGQPGPKGEQGPEGVGRPGKPGQPGLPGVQGPPGLKGVQG
EPGPPGRGVQGPQGEPGAPGLPGIQGLPGPRGPPGPTGEKGAQGSPGVKGATGPVGPPGA
SVSGPPGRDGQQGQTGLRGTPGEKGPRGEKGEPGECSCPSQGDLIFSGMPGAPGLWMGSS
WQPGPQGPPGIPGPPGPPGVPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGDCV
QGQRAHPGYLVEKGEKGDQGIPGVPGLDNCAQCFLSLERPRAEEARGDNSEGDPGCVGSP
GLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDK
GEPGPPGQPGYPGATGPPGLPGIKGERGYTGSAGEKGEPGPPGSEGLPGPPGPAGPRGER
GPQGNSGEKGDQGFQGQPGFPGPPGPPGFPGKVGSPGPPGPQAEKGSEGIRGPSGLPGSP
GPPGPPGIQGPAGLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDC
GKPGPPGSTGRPGAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATG
ERGLAGLPGQPGPPGHPGPPGEPGTDGAAGKEGPPGKQGFYGPPGPKGDPGAAGQKGQAG
EKGRAGMPGGPGKSGSMGPVGPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIK
RFIRQEIIKMFDERMAYYTSRMQFPMEMAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIG
REGRQGLPGVRGLPGTKGEKGDIGIGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIP
GIPGPPGPMGQPGKAGHCNPSDCFGAMPMEQQYPPMKTMKGPFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07092	0.999	0.999	0.000	1604	1.000	1.000	Q07092.pdb.gz	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
2	AFDB:Q8BLX7	0.209	0.212	0.000	1580	0.875	0.888	Q8BLX7.pdb.gz	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
3	AFDB:G3MXK9	0.152	0.190	6.087E-94	1257	0.559	0.714	G3MXK9.pdb.gz	G3MXK9_BOVIN Collagen type XVI alpha 1 chain OS=Bos taurus OX=9913 GN=COL16A1 PE=4 SV=2
4	AFDB:Q8NFW1	0.137	0.135	1.198E-36	1626	0.394	0.389	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
5	AFDB:E9Q7P1	0.135	0.134	9.979E-36	1613	0.386	0.384	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
6	AFDB:A0A0R4IR54	0.141	0.139	4.190E-34	1622	0.371	0.367	A0A0R4IR54.pdb.gz
7	AFDB:Q0VF58	0.137	0.190	4.802E-32	1136	0.312	0.440	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
8	AFDB:Q14993	0.136	0.190	4.802E-32	1142	0.315	0.443	Q14993.pdb.gz	COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens OX=9606 GN=COL19A1 PE=1 SV=3
9	AFDB:P12107	0.114	0.103	9.203E-20	1806	0.363	0.323	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
10	AFDB:Q9JLI2	0.114	0.105	1.608E-19	1739	0.350	0.323	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
11	PDB:3v0aB	0.090	0.123	1.196E-7	1150	0.016	0.023	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
12	PDB:5n0cA	0.093	0.115	1.495E-7	1293	0.014	0.017	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
13	PDB:3vv1A	0.075	0.641	2.209E-7	141	0.012	0.135	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
14	PDB:1b09A	0.083	0.543	2.057E-6	206	0.012	0.092	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
15	PDB:7zl1A	0.072	0.448	2.875E-6	215	0.017	0.126	7zl1A.pdb.gz
16	PDB:3ffzA	0.081	0.103	4.492E-6	1246	0.006	0.008	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
17	PDB:7qfqA	0.081	0.099	5.311E-6	1291	0.010	0.012	7qfqA.pdb.gz
18	PDB:3afkA	0.072	0.480	9.809E-6	167	0.012	0.120	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
19	PDB:4pbpB	0.070	0.451	1.533E-5	210	0.015	0.114	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
20	PDB:3zxfB	0.075	0.648	2.395E-5	138	0.012	0.138	3zxfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3MXK9	0.0	810	1257	0.325	0.415	G3MXK9_BOVIN Collagen type XVI alpha 1 chain OS=Bos taurus OX=9913 GN=COL16A1 PE=4 SV=2
2	Q07092	0.0	2960	1604	1.000	1.000	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
3	Q8BLX7	0.0	1964	1580	0.871	0.884	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
4	P08120	7.13e-108	382	1779	0.335	0.302	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
5	M5BFV8	3.31e-102	364	1622	0.334	0.330	M5BFV8_DANRE Collagen alpha-1(XXII) chain precursor OS=Danio rerio OX=7955 GN=prp PE=1 SV=1
6	O18407	4.13e-93	337	1761	0.304	0.277	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
7	Q9VMV5	7.13e-92	333	1940	0.307	0.254	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
8	P17139	1.06e-91	332	1759	0.339	0.309	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
9	A0MSJ1	1.38e-81	300	1658	0.251	0.243	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
10	Q17RW2	1.46e-78	290	1714	0.258	0.242	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
11	P17140	1.13e-77	288	1758	0.298	0.272	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
12	B1AVK5	3.42e-77	286	1691	0.320	0.304	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
13	Q9ESQ1	2.98e-75	280	1691	0.319	0.303	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
14	Q14031	4.14e-74	276	1691	0.302	0.287	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
15	F1MA59	1.09e-71	268	1669	0.303	0.291	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
16	P02466	5.61e-70	261	1372	0.277	0.324	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
17	F1KQQ4	7.78e-70	262	1759	0.324	0.295	F1KQQ4_ASCSU Collagen alpha-1(IV) chain (Fragment) OS=Ascaris suum OX=6253 PE=2 SV=1
18	P08122	7.69e-69	259	1707	0.258	0.243	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
19	A0A8I6AFK7	8.65e-69	258	1562	0.303	0.311	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
20	P02463	1.74e-68	258	1669	0.292	0.280	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1e-139	465.7	Collagen triple helix repeat (20 copies)
2	PF17264 DUF5330	4.7e+02	12.2	Family of unknown function (DUF5330)
3	PF02210 Laminin_G_2	2.7e+02	13.6	Laminin G domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401749	0.922	Prolyl 4-hydroxylase subunit alpha-3
2	9606.ENSP00000263556	0.912	Prolyl 4-hydroxylase subunit alpha-1
3	9606.ENSP00000361405	0.911	Matrix metalloproteinase-9
4	9606.ENSP00000384999	0.909	Prolyl 4-hydroxylase subunit alpha-2
5	9606.ENSP00000325146	0.856	Collagen alpha-1(XII) chain
6	9606.ENSP00000297848	0.814	Collagen alpha-1(XIV) chain
7	9606.ENSP00000361834	0.768	Collagen alpha-2(IX) chain
8	9606.ENSP00000349790	0.766	Collagen alpha-1(IX) chain
9	9606.ENSP00000341640	0.765	Collagen alpha-3(IX) chain
10	9606.ENSP00000359114	0.754	Collagen alpha-1(XI) chain
11	9606.ENSP00000300527	0.742	Collagen alpha-2(VI) chain
12	9606.ENSP00000264828	0.733	Collagen alpha-3(V) chain
13	9606.ENSP00000360882	0.725	Collagen alpha-1(V) chain
14	9606.ENSP00000236040	0.723	Prolyl 3-hydroxylase 1
15	9606.ENSP00000225964	0.719	Collagen alpha-1(I) chain
16	9606.ENSP00000282903	0.719	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
17	9606.ENSP00000196061	0.713	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
18	9606.ENSP00000354960	0.700	Procollagen galactosyltransferase 2
19	9606.ENSP00000296585	0.683	Integrin alpha-2
20	9606.ENSP00000304408	0.679	Collagen alpha-1(III) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:0005178	0.995	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.967	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0032501	0.942	multicellular organismal process
GO:0050794	0.921	regulation of cellular process
GO:0050896	0.899	response to stimulus
GO:0051716	0.802	cellular response to stimulus
GO:0071840	0.801	cellular component organization or biogenesis
GO:0032502	0.766	developmental process
GO:0048856	0.746	anatomical structure development
GO:0042221	0.746	response to chemical
GO:0016043	0.712	cellular component organization
GO:0048518	0.560	positive regulation of biological process
GO:0048522	0.508	positive regulation of cellular process
GO:0007154	0.492	cell communication
GO:0023052	0.487	signaling
GO:0007165	0.468	signal transduction
GO:0007275	0.441	multicellular organism development
GO:0007155	0.422	cell adhesion
GO:0007166	0.341	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0012505	0.998	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0005737	0.995	cytoplasm
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005576	0.988	extracellular region
GO:0032991	0.986	protein-containing complex
GO:0005788	0.962	endoplasmic reticulum lumen
GO:0005581	0.924	collagen trimer
GO:0005615	0.794	extracellular space
GO:0005597	0.382	collagen type XVI trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]