StarFunc result for job id Q07157

User Input

>input (1748 residues)
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHAD
DHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPT
PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLK
QPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRY
EDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSY
DSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYE
QVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK
PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHD
KTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHL
SEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQ
PVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYP
QKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHK
PDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSA
VEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS
ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANC
VSVLIDHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1D5NS76	0.397	0.353	0.000	2005	0.655	0.571	A0A1D5NS76.pdb.gz
2	AFDB:A0A2R8QMK9	0.319	0.328	0.000	1689	0.648	0.670	A0A2R8QMK9.pdb.gz
3	AFDB:O97758	0.309	0.306	0.000	1769	0.941	0.929	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
4	AFDB:P39447	0.435	0.436	0.000	1745	0.909	0.911	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
5	AFDB:A0A0B4K6Y7	0.294	0.223	1.441E-83	2395	0.303	0.221	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
6	AFDB:F1R3X0	0.259	0.340	9.152E-75	1255	0.236	0.328	F1R3X0.pdb.gz
7	AFDB:H0YKB1	0.078	0.295	8.973E-47	383	0.192	0.877	H0YKB1.pdb.gz	H0YKB1_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
8	PDB:2xkxA	0.122	0.252	1.801E-34	721	0.107	0.259	2xkxA.pdb.gz
9	AFDB:Q5TCQ9	0.089	0.100	9.417E-15	1481	0.086	0.101	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
10	AFDB:G5ECZ8	0.072	0.061	7.520E-12	2422	0.148	0.107	G5ECZ8.pdb.gz	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
11	AFDB:Q9V9S7	0.055	0.054	9.871E-9	1866	0.138	0.129	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
12	PDB:7mixC	0.085	0.294	5.150E-8	324	0.029	0.154	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
13	PDB:7p73A	0.054	0.216	8.011E-8	420	0.017	0.071	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7pc3A	0.049	0.203	2.202E-6	405	0.015	0.067	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6t36A	0.047	0.836	2.006E-5	93	0.011	0.215	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7qqmA	0.049	0.203	2.006E-5	413	0.018	0.075	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7qqnC	0.047	0.188	3.120E-5	414	0.016	0.068	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7p70A	0.045	0.192	5.129E-5	407	0.015	0.064	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:5n7dA	0.047	0.190	5.420E-5	423	0.013	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:4f4jA	0.074	0.551	5.728E-5	189	0.018	0.164	4f4jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087X0K9	3572	1768	1.000	0.989	A0A087X0K9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
2	A0A0G2K2P5	3192	1765	0.910	0.901	ZO1_RAT Tight junction protein ZO-1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=1
3	A0A8I6ALD4	770	1239	0.237	0.335	A0A8I6ALD4_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
4	A0A8I6AP88	768	1129	0.244	0.377	A0A8I6AP88_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
5	A0A8I6GLX8	769	1189	0.237	0.349	A0A8I6GLX8_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=4 SV=1
6	A0A8J8Y4W9	769	1166	0.237	0.356	A0A8J8Y4W9_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
7	D3Z8G7	620	906	0.219	0.422	D3Z8G7_RAT Tight junction protein 3 OS=Rattus norvegicus OX=10116 GN=Tjp3 PE=1 SV=3
8	F1M4A0	3163	1725	0.895	0.907	F1M4A0_RAT Tight junction protein 1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=3
9	G3V1L9	3554	1861	0.995	0.934	G3V1L9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
10	G5E9E7	3122	1692	0.914	0.944	G5E9E7_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
11	H0YKB1	681	383	0.192	0.877	H0YKB1_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
12	O95049	645	919	0.225	0.429	ZO3_HUMAN Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3 PE=1 SV=3
13	O97758	3262	1769	0.941	0.930	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
14	P39447	3191	1745	0.909	0.911	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
15	P70625	651	813	0.201	0.432	P70625_RAT Zonula occludens 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=ZO-2 PE=2 SV=2
16	Q07157	3582	1748	1.000	1.000	ZO1_HUMAN Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3
17	Q3ZB99	769	1164	0.237	0.357	Q3ZB99_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
18	Q95168	754	1174	0.238	0.354	ZO2_CANLF Tight junction protein ZO-2 OS=Canis lupus familiaris OX=9615 GN=TJP2 PE=1 SV=1
19	Q9UDY2	749	1190	0.233	0.342	ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2
20	Q9Z0U1	758	1167	0.233	0.350	ZO2_MOUSE Tight junction protein ZO-2 OS=Mus musculus OX=10090 GN=Tjp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	4.9	17.8	Family of unknown function (DUF6288)
2	PF00625 Guanylate_kin	1.5e-09	49.3	Guanylate kinase
3	PF00595 PDZ	2.8e-44	160.7	PDZ domain
4	PF13180 PDZ_2	7.5e-11	53.6	PDZ domain
5	PF17820 PDZ_6	3.9e-23	92.4	PDZ domain
6	PF02163 Peptidase_M50	7e-10	50.3	Peptidase family M50
7	PF14700 RPOL_N	3.2e+02	12.1	DNA-directed RNA polymerase N-terminal
8	PF00018 SH3_1	7	17.7	SH3 domain
9	PF07653 SH3_2	1.1e-07	42.8	Variant SH3 domain
10	PF00791 ZU5	9e-27	104.5	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000271636	0.999	Cingulin
2	9606.ENSP00000282561	0.999	Gap junction alpha-1 protein
3	9606.ENSP00000347379	0.999	Occludin
4	9606.ENSP00000357005	0.999	Junctional adhesion molecule A
5	9606.ENSP00000228251	0.998	Y-box-binding protein 3
6	9606.ENSP00000344456	0.998	Catenin beta-1
7	9606.ENSP00000375960	0.998	Afadin
8	9606.ENSP00000362680	0.997	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000299106	0.996	Junctional adhesion molecule C
10	9606.ENSP00000441283	0.996	Claudin-2
11	9606.ENSP00000264734	0.995	Claudin-16
12	9606.ENSP00000290374	0.995	Gap junction delta-2 protein
13	9606.ENSP00000323264	0.995	MARVEL domain-containing protein 2
14	9606.ENSP00000365745	0.995	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
15	9606.ENSP00000409544	0.994	Claudin-4
16	9606.ENSP00000261769	0.993	Cadherin-1
17	9606.ENSP00000352138	0.993	Kin of IRRE-like protein 1
18	9606.ENSP00000385477	0.992	Claudin-5
19	9606.ENSP00000382004	0.990	Catenin delta-1
20	9606.ENSP00000357722	0.988	Protein S100-A8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.332	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0034330	0.950	cell junction organization
GO:0045216	0.913	cell-cell junction organization
GO:0065007	0.893	biological regulation
GO:0050794	0.877	regulation of cellular process
GO:0007043	0.877	cell-cell junction assembly
GO:0032501	0.734	multicellular organismal process
GO:0050896	0.699	response to stimulus
GO:0048518	0.576	positive regulation of biological process
GO:0048522	0.463	positive regulation of cellular process
GO:0051716	0.439	cellular response to stimulus
GO:0048519	0.430	negative regulation of biological process
GO:0048856	0.413	anatomical structure development
GO:0048523	0.366	negative regulation of cellular process
GO:0051239	0.323	regulation of multicellular organismal process
GO:0051179	0.313	localization
GO:0042221	0.302	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.992	cytosol
GO:0070161	0.965	anchoring junction
GO:0005911	0.926	cell-cell junction
GO:0043227	0.811	membrane-bounded organelle
GO:0043229	0.810	intracellular organelle
GO:0043231	0.776	intracellular membrane-bounded organelle
GO:0043296	0.716	apical junction complex
GO:0070160	0.715	tight junction
GO:0005923	0.659	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]