StarFunc result for job id Q07283

User Input

>input (1943 residues)
MSPLLRSICDITEIFNQYVSHDCDGAALTKKDLKNLLEREFGAVLRRPHDPKTVDLILEL
LDLDSNGRVDFNEFLLFIFKVAQACYYALGQATGLDEEKRARCDGKESLLQDRRQEEDQR
RFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRDRQRRDEELWRQRQEW
QEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQE
EEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRL
RREQQLRRKQEEERREQQEERREQQERREQQEERREQQLRREQEERREQQLRREQEEERR
EQQLRREQEEERREQQLRREQQLRREQQLRREQQLRREQQLRREQQLRREQQLRREQQLR
REQQLRREQEEERHEQKHEQERREQRLKREQEERRDWLKREEETERHEQERRKQQLKRDQ
EEERRERWLKLEEEERREQQERREQQLRREQEERREQRLKRQEEEERLQQRLRSEQQLRR
EQEERREQLLKREEEKRLEQERREQRLKREQEERRDQLLKREEERRQQRLKREQEERLEQ
RLKREEVERLEQEERREQRLKREEPEEERRQQLLKSEEQEERRQQQLRREQQERREQRLK
REEEEERLEQRLKREHEEERREQELAEEEQEQARERIKSRIPKWQWQLESEADARQSKVY
SRPRKQEGQRRRQEQEEKRRRRESELQWQEEERAHRQQQEEEQRRDFTWQWQAEEKSERG
RQRLSARPPLREQRERQLRAEERQQREQRFLPEEEEKEQRRRQRREREKELQFLEEEEQL
QRRERAQQLQEEEDGLQEDQERRRSQEQRRDQKWRWQLEEERKRRRHTLYAKPALQEQLR
KEQQLLQEEEEELQREEREKRRRQEQERQYREEEQLQQEEEQLLREEREKRRRQERERQY
RKDKKLQQKEEQLLGEEPEKRRRQEREKKYREEEELQQEEEQLLREEREKRRRQEWERQY
RKKDELQQEEEQLLREEREKRRLQERERQYREEEELQQEEEQLLGEERETRRRQELERQY
RKEEELQQEEEQLLREEPEKRRRQERERQCREEEELQQEEEQLLREEREKRRRQELERQY
REEEEVQQEEEQLLREEPEKRRRQELERQYREEEELQQEEEQLLREEQEKRRQERERQYR
EEEELQRQKRKQRYRDEDQRSDLKWQWEPEKENAVRDNKVYCKGRENEQFRQLEDSQLRD
RQSQQDLQHLLGEQQERDREQERRRWQQRDRHFPEEEQLEREEQKEAKRRDRKSQEEKQL
LREEREEKRRRQETDRKFREEEQLLQEREEQPLRRQERDRKFREEELRHQEQGRKFLEEE
QRLRRQERERKFLKEEQQLRCQEREQQLRQDRDRKFREEEQQLSRQERDRKFREEEQQVR
RQERERKFLEEEQQLRQERHRKFREEEQLLQEREEQQLHRQERDRKFLEEEQQLRRQERD
RKFREQELRSQEPERKFLEEEQQLHRQQRQRKFLQEEQQLRRQERGQQRRQDRDRKFREE
EQLRQEREEQQLSRQERDRKFRLEEQKVRRQEQERKFMEDEQQLRRQEGQQQLRQERDRK
FREDEQLLQEREEQQLHRQERDRKFLEEEPQLRRQEREQQLRHDRDRKFREEEQLLQEGE
EQQLRRQERDRKFREEEQQLRRQERERKFLQEEQQLRRQELERKFREEEQLRQETEQEQL
RRQERYRKILEEEQLRPEREEQQLRRQERDRKFREEEQLRQEREEQQLRSQESDRKFREE
EQLRQEREEQQLRPQQRDGKYRWEEEQLQLEEQEQRLRQERDRQYRAEEQFATQEKSRRE
EQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQF
ASVPVRSSPLYEYIQEQRSQYRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07283	1.000	1.000	0.000	1943	1.000	1.000	Q07283.pdb.gz	TRHY_HUMAN Trichohyalin OS=Homo sapiens OX=9606 GN=TCHH PE=1 SV=2
2	AFDB:A0A0B4J1F9	0.055	0.066	3.788E-22	1599	0.423	0.514	A0A0B4J1F9.pdb.gz	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
3	PDB:2lucA	0.035	0.545	9.317E-3	105	0.011	0.210	2lucA.pdb.gz
4	PDB:2k2fA	0.040	0.680	2.613E-2	93	0.013	0.269	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
5	PDB:6zdyA	0.039	0.580	2.751E-2	108	0.007	0.130	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
6	PDB:5csnA	0.041	0.752	2.897E-2	94	0.014	0.287	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
7	PDB:7psqG	0.046	0.655	3.560E-2	108	0.012	0.222	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
8	PDB:5hloC	0.033	0.509	5.378E-2	93	0.013	0.269	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
9	PDB:7nmiB	0.035	0.131	6.278E-2	488	0.012	0.047	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
10	PDB:2kayA	0.033	0.542	1.107E-1	92	0.008	0.163	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
11	PDB:4hrgA	0.038	0.494	1.107E-1	114	0.013	0.228	4hrgA.pdb.gz	SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
12	PDB:7u0tA	0.027	0.228	1.854E-1	190	0.011	0.111	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
13	AFDB:G5EBY3	0.045	0.044	4.093	2003	0.129	0.125	G5EBY3.pdb.gz	G5EBY3_CAEEL Myosin-11 OS=Caenorhabditis elegans OX=6239 GN=nmy-2 PE=1 SV=1
14	AFDB:Q54BP1	0.030	0.029	5.296	2110	0.035	0.032	Q54BP1.pdb.gz	Q54BP1_DICDI Centrosomal protein 248 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293544 PE=4 SV=1
15	AFDB:Q9CS72	0.067	0.097	5.576	1211	0.071	0.114	Q9CS72.pdb.gz	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
16	AFDB:Q8L7E5	0.031	0.077	5.872	703	0.034	0.094	Q8L7E5.pdb.gz	WIT1_ARATH WPP domain-interacting tail-anchored protein 1 OS=Arabidopsis thaliana OX=3702 GN=WIT1 PE=1 SV=2
17	AFDB:P49054	0.032	0.110	6.182	388	0.039	0.196	P49054.pdb.gz	PAM_STRPY Plasminogen-binding group A streptococcal M-like protein PAM (Fragment) OS=Streptococcus pyogenes OX=1314 GN=pam PE=1 SV=1
18	AFDB:Q9VEH0	0.037	0.074	7.216	842	0.036	0.083	Q9VEH0.pdb.gz	Q9VEH0_DROME Aluminum tubes, isoform A OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
19	AFDB:Q8GYX3	0.033	0.105	8.869	513	0.033	0.127	Q8GYX3.pdb.gz	MP705_ARATH Microtubule-associated protein 70-5 OS=Arabidopsis thaliana OX=3702 GN=MAP70.5 PE=1 SV=1
20	AFDB:B9V5F5	0.040	0.101	9.833	649	0.057	0.171	B9V5F5.pdb.gz	CE63A_XENLA Centrosomal protein of 63 kDa-A OS=Xenopus laevis OX=8355 GN=cep63-a PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07283	0.0	3211	1943	1.000	1.000	TRHY_HUMAN Trichohyalin OS=Homo sapiens OX=9606 GN=TCHH PE=1 SV=2
2	P97347	4.49e-26	119	1118	0.024	0.041	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
3	Q6XPR3	5.21e-24	112	784	0.022	0.055	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
4	Q9UBG3	1.00e-20	100	495	0.025	0.097	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
5	Q2VIS4	9.28e-19	96.3	2362	0.023	0.019	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
6	Q05331	1.85e-14	82.0	1218	0.021	0.033	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
7	P20930	4.92e-14	80.9	4061	0.021	0.010	FILA_HUMAN Filaggrin OS=Homo sapiens OX=9606 GN=FLG PE=1 SV=3
8	Q5D862	4.42e-13	77.8	2391	0.021	0.017	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
9	Q8CIU0	3.51e-08	60.8	501	0.016	0.062	Q8CIU0_RAT Profilaggrin (Fragment) OS=Rattus norvegicus OX=10116 GN=Flg PE=4 SV=1
10	A0A0B4J1F9	3.70e-07	58.2	1599	0.057	0.069	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
11	Q8I4Z1	3.54e-04	48.1	1846	0.024	0.025	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
12	A1Z9M5	0.003	45.4	4012	0.045	0.022	A1Z9M5_DROME Titin OS=Drosophila melanogaster OX=7227 GN=Sdb PE=1 SV=1
13	Q3V203	0.039	41.6	1135	0.024	0.041	Q3V203_MOUSE Trichohyalin (Fragment) OS=Mus musculus OX=10090 GN=Tchh PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	37	15.3	EF hand
2	PF13405 EF-hand_6	37	15.5	EF-hand domain
3	PF13833 EF-hand_8	1.9e+02	13.2	EF-hand domain pair
4	PF01023 S_100	6.6e-08	43.4	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357753	0.966	Involucrin
2	9606.ENSP00000317895	0.937	Repetin
3	9606.ENSP00000393417	0.932	Caspase-14
4	9606.ENSP00000264474	0.917	Cystatin-A
5	9606.ENSP00000357731	0.910	Loricrin
6	9606.ENSP00000243924	0.906	Elafin
7	9606.ENSP00000357751	0.862	Cornifin-A
8	9606.ENSP00000330391	0.837	Small proline-rich protein 3
9	9606.ENSP00000306461	0.836	Cornifin-B
10	9606.ENSP00000364609	0.764	Protein-arginine deiminase type-3
11	9606.ENSP00000357778	0.752	Late cornified envelope protein 3E
12	9606.ENSP00000206765	0.737	Protein-glutamine gamma-glutamyltransferase K
13	9606.ENSP00000333952	0.735	Late cornified envelope protein 5A
14	9606.ENSP00000335358	0.733	Late cornified envelope protein 3B
15	9606.ENSP00000357801	0.731	Protein S100-A10
16	9606.ENSP00000334644	0.714	Late cornified envelope protein 3C
17	9606.ENSP00000301607	0.704	Envoplakin
18	9606.ENSP00000357736	0.704	Late cornified envelope like proline rich 1
19	9606.ENSP00000340510	0.698	Periplakin
20	9606.ENSP00000411070	0.688	Late cornified envelope protein 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005515	0.747	protein binding
GO:0042802	0.307	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0097435	0.998	supramolecular fiber organization
GO:0007010	0.995	cytoskeleton organization
GO:0045109	0.988	intermediate filament organization
GO:0032502	0.316	developmental process
GO:0065007	0.314	biological regulation
GO:0048856	0.310	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0001533	0.999	cornified envelope
GO:0043226	0.940	organelle
GO:0043229	0.853	intracellular organelle
GO:0043232	0.719	intracellular non-membrane-bounded organelle
GO:0043227	0.684	membrane-bounded organelle
GO:0043231	0.369	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]