StarFunc result for job id Q07325

User Input

>input (125 residues)
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07325	1.000	1.000	1.924E-19	125	1.000	1.000	Q07325.pdb.gz	CXCL9_HUMAN C-X-C motif chemokine 9 OS=Homo sapiens OX=9606 GN=CXCL9 PE=1 SV=1
2	AFDB:P18340	0.683	0.678	7.012E-14	126	0.632	0.627	P18340.pdb.gz	CXCL9_MOUSE C-X-C motif chemokine 9 OS=Mus musculus OX=10090 GN=Cxcl9 PE=2 SV=2
3	AFDB:Q8K4B1	0.719	0.719	4.409E-13	125	0.608	0.608	Q8K4B1.pdb.gz	Q8K4B1_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl9 PE=2 SV=1
4	AFDB:P48973	0.578	0.702	4.615E-9	98	0.280	0.357	P48973.pdb.gz	CXL10_RAT C-X-C motif chemokine 10 OS=Rattus norvegicus OX=10116 GN=Cxcl10 PE=2 SV=2
5	AFDB:P02778	0.552	0.698	8.699E-9	98	0.296	0.378	P02778.pdb.gz	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
6	AFDB:P19876	0.604	0.693	1.356E-8	107	0.280	0.327	P19876.pdb.gz	CXCL3_HUMAN C-X-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CXCL3 PE=1 SV=1
7	AFDB:P17515	0.647	0.802	2.113E-8	98	0.304	0.388	P17515.pdb.gz	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
8	AFDB:P19875	0.520	0.605	9.677E-8	107	0.288	0.336	P19875.pdb.gz	CXCL2_HUMAN C-X-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CXCL2 PE=1 SV=1
9	AFDB:P14095	0.536	0.685	1.170E-7	96	0.232	0.302	P14095.pdb.gz	GROA_RAT Growth-regulated alpha protein OS=Rattus norvegicus OX=10116 GN=Cxcl1 PE=1 SV=2
10	AFDB:P10145	0.526	0.660	1.247E-7	99	0.208	0.263	P10145.pdb.gz	IL8_HUMAN Interleukin-8 OS=Homo sapiens OX=9606 GN=CXCL8 PE=1 SV=1
11	PDB:1o80A	0.490	0.798	1.856E-6	74	0.224	0.378	1o80A.pdb.gz
12	PDB:2mgsA	0.454	0.766	2.107E-6	71	0.208	0.366	2mgsA.pdb.gz
13	PDB:1qe6D	0.507	0.854	4.233E-6	72	0.168	0.292	1qe6D.pdb.gz
14	PDB:1qnkA	0.462	0.794	6.597E-6	69	0.248	0.449	1qnkA.pdb.gz
15	PDB:1f9pA	0.455	0.690	7.489E-6	81	0.184	0.284	1f9pA.pdb.gz
16	PDB:1mgsA	0.442	0.728	1.028E-5	73	0.232	0.397	1mgsA.pdb.gz
17	PDB:1f9rA	0.444	0.811	1.819E-5	65	0.152	0.292	1f9rA.pdb.gz
18	PDB:1nr4E	0.448	0.765	4.614E-4	69	0.168	0.304	1nr4E.pdb.gz
19	PDB:1esrA	0.449	0.703	8.163E-4	76	0.096	0.158	1esrA.pdb.gz
20	PDB:1bo0A	0.423	0.655	9.267E-4	76	0.120	0.197	1bo0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07325	3.48e-85	246	125	1.000	1.000	CXCL9_HUMAN C-X-C motif chemokine 9 OS=Homo sapiens OX=9606 GN=CXCL9 PE=1 SV=1
2	Q8K4B1	1.41e-44	143	125	0.648	0.648	Q8K4B1_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl9 PE=2 SV=1
3	P18340	3.01e-43	140	126	0.520	0.516	CXCL9_MOUSE C-X-C motif chemokine 9 OS=Mus musculus OX=10090 GN=Cxcl9 PE=2 SV=2
4	P17515	7.44e-17	72.0	98	0.304	0.388	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
5	P02778	2.83e-15	68.2	98	0.296	0.378	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
6	P19875	9.78e-15	67.0	107	0.264	0.308	CXCL2_HUMAN C-X-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CXCL2 PE=1 SV=1
7	P14095	2.27e-14	65.9	96	0.240	0.312	GROA_RAT Growth-regulated alpha protein OS=Rattus norvegicus OX=10116 GN=Cxcl1 PE=1 SV=2
8	P80221	4.49e-14	65.5	112	0.232	0.259	CXCL6_BOVIN C-X-C motif chemokine 6 OS=Bos taurus OX=9913 GN=CXCL6 PE=1 SV=2
9	P12850	3.75e-13	62.4	96	0.232	0.302	GROA_MOUSE Growth-regulated alpha protein OS=Mus musculus OX=10090 GN=Cxcl1 PE=1 SV=1
10	O14625	8.38e-13	61.6	94	0.280	0.372	CXL11_HUMAN C-X-C motif chemokine 11 OS=Homo sapiens OX=9606 GN=CXCL11 PE=1 SV=1
11	P42830	1.96e-12	61.2	114	0.216	0.237	CXCL5_HUMAN C-X-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CXCL5 PE=1 SV=1
12	Q6I9S7	1.96e-12	61.2	114	0.216	0.237	Q6I9S7_HUMAN C-X-C motif chemokine OS=Homo sapiens OX=9606 GN=CXCL5 PE=1 SV=1
13	P19876	2.16e-12	60.8	107	0.240	0.280	CXCL3_HUMAN C-X-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CXCL3 PE=1 SV=1
14	A3DTN6	8.30e-12	59.3	103	0.240	0.291	A3DTN6_CHICK Multifunctional fusion protein OS=Gallus gallus OX=9031 GN=IL8 PE=2 SV=2
15	P08317	8.30e-12	59.3	103	0.240	0.291	IL8_CHICK Interleukin-8 OS=Gallus gallus OX=9031 GN=CXCL8 PE=2 SV=1
16	B0R191	2.42e-11	58.5	121	0.280	0.289	CX116_DANRE C-X-C motif chemokine 11-6 OS=Danio rerio OX=7955 GN=cxcl11.6 PE=2 SV=1
17	P82535	4.36e-11	56.6	76	0.216	0.355	AMC_RABIT Alveolar macrophage chemotactic factor OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
18	P09341	4.60e-11	57.4	107	0.232	0.271	GROA_HUMAN Growth-regulated alpha protein OS=Homo sapiens OX=9606 GN=CXCL1 PE=1 SV=1
19	P48973	5.57e-11	57.0	98	0.248	0.316	CXL10_RAT C-X-C motif chemokine 10 OS=Rattus norvegicus OX=10116 GN=Cxcl10 PE=2 SV=2
20	A0A0R4IQ43	5.70e-11	57.4	106	0.272	0.321	A0A0R4IQ43_DANRE C-X-C motif chemokine 11-6-like OS=Danio rerio OX=7955 GN=cxcl11.5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	9.9e-12	56.2	Small cytokines (intecrine/chemokine), interleukin-8 like
2	PF10037 MRP-S27	53	14.2	Mitochondrial 28S ribosomal protein S27

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362795	0.999	C-X-C chemokine receptor type 3
2	9606.ENSP00000221972	0.989	B-cell antigen receptor complex-associated protein alpha chain
3	9606.ENSP00000305651	0.989	C-X-C motif chemokine 10
4	9606.ENSP00000296029	0.982	Platelet factor 4
5	9606.ENSP00000306884	0.982	C-X-C motif chemokine 11
6	9606.ENSP00000286758	0.969	C-X-C motif chemokine 13
7	9606.ENSP00000376544	0.968	B-cell antigen receptor complex-associated protein beta chain
8	9606.ENSP00000292303	0.928	C-C chemokine receptor type 5
9	9606.ENSP00000226524	0.921	Platelet factor 4 variant
10	9606.ENSP00000474412	0.917	C-C motif chemokine 5
11	9606.ENSP00000345083	0.903	Dual specificity mitogen-activated protein kinase kinase 3
12	9606.ENSP00000225831	0.901	C-C motif chemokine 2
13	9606.ENSP00000312999	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-2
14	9606.ENSP00000334448	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
15	9606.ENSP00000468348	0.900	Dual specificity mitogen-activated protein kinase kinase 6
16	9606.ENSP00000481878	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
17	9606.ENSP00000441600	0.899	C-C chemokine receptor type 3
18	9606.ENSP00000379140	0.890	Stromal cell-derived factor 1
19	9606.ENSP00000477908	0.886	C-C motif chemokine 3
20	9606.ENSP00000482259	0.883	C-C motif chemokine 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0045236	0.395	CXCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048518	0.994	positive regulation of biological process
GO:0051716	0.988	cellular response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0006950	0.964	response to stress
GO:0009605	0.962	response to external stimulus
GO:0042221	0.953	response to chemical
GO:0007165	0.944	signal transduction
GO:0002376	0.940	immune system process
GO:0006952	0.939	defense response
GO:0048522	0.930	positive regulation of cellular process
GO:0042330	0.909	taxis
GO:0006935	0.904	chemotaxis
GO:0044419	0.898	biological process involved in interspecies interaction between organisms
GO:0098542	0.887	defense response to other organism
GO:0006959	0.840	humoral immune response
GO:0007186	0.811	G protein-coupled receptor signaling pathway
GO:0051050	0.795	positive regulation of transport
GO:0061844	0.772	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0001906	0.771	cell killing
GO:0031640	0.739	killing of cells of another organism
GO:0048583	0.729	regulation of response to stimulus
GO:0051924	0.654	regulation of calcium ion transport
GO:0051282	0.639	regulation of sequestering of calcium ion
GO:0051928	0.633	positive regulation of calcium ion transport
GO:0007188	0.581	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0051281	0.578	positive regulation of release of sequestered calcium ion into cytosol
GO:0006954	0.573	inflammatory response
GO:0006968	0.568	cellular defense response
GO:0007189	0.551	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048584	0.488	positive regulation of response to stimulus
GO:0042127	0.419	regulation of cell population proliferation
GO:0070887	0.409	cellular response to chemical stimulus
GO:0032101	0.390	regulation of response to external stimulus
GO:0002684	0.376	positive regulation of immune system process
GO:0032103	0.342	positive regulation of response to external stimulus
GO:0040012	0.335	regulation of locomotion
GO:0032501	0.334	multicellular organismal process
GO:0019222	0.334	regulation of metabolic process
GO:0010033	0.330	response to organic substance
GO:0048519	0.323	negative regulation of biological process
GO:0048523	0.308	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0016020	0.960	membrane
GO:0071944	0.936	cell periphery
GO:0005886	0.910	plasma membrane
GO:0043231	0.715	intracellular membrane-bounded organelle
GO:0009986	0.465	cell surface
GO:0005737	0.455	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]