StarFunc result for job id Q07326

User Input

>input (219 residues)
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYL
VVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILS
TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERP
WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07326	1.000	1.000	6.438E-29	219	1.000	1.000	Q07326.pdb.gz	PIGF_HUMAN Phosphatidylinositol-glycan biosynthesis class F protein OS=Homo sapiens OX=9606 GN=PIGF PE=1 SV=1
2	AFDB:O09101	0.994	0.994	1.107E-25	219	0.877	0.877	O09101.pdb.gz	PIGF_MOUSE Phosphatidylinositol-glycan biosynthesis class F protein OS=Mus musculus OX=10090 GN=Pigf PE=1 SV=1
3	AFDB:Q5AFT2	0.669	0.565	8.941E-7	265	0.210	0.174	Q5AFT2.pdb.gz	GPI11_CANAL Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI11 PE=3 SV=1
4	AFDB:Q06636	0.520	0.520	1.033E-4	219	0.183	0.183	Q06636.pdb.gz	GPI11_YEAST Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI11 PE=1 SV=1
5	PDB:6w6l4	0.275	0.273	4.398E-1	221	0.123	0.122	6w6l4.pdb.gz	An ER translocon for multi-pass membrane protein biogenesis.
6	PDB:7epaA	0.254	0.100	4.607E-1	782	0.119	0.033	7epaA.pdb.gz
7	AFDB:P13773	0.200	0.136	4.722E-1	392	0.183	0.102	P13773.pdb.gz	CAR1_DICDI Cyclic AMP receptor 1 OS=Dictyostelium discoideum OX=44689 GN=carA-1 PE=1 SV=1
8	AFDB:P35352	0.211	0.118	5.429E-1	490	0.183	0.082	P35352.pdb.gz	CAR3_DICDI Cyclic AMP receptor 3 OS=Dictyostelium discoideum OX=44689 GN=carC PE=2 SV=1
9	AFDB:O13752	0.216	0.175	6.243E-1	290	0.164	0.124	O13752.pdb.gz	YF22_SCHPO Uncharacterized TLC domain-containing protein C17A2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17A2.02c PE=4 SV=1
10	AFDB:Q22541	0.292	0.210	6.243E-1	360	0.142	0.086	Q22541.pdb.gz	Q22541_CAEEL Zinc transporter 2 OS=Caenorhabditis elegans OX=6239 GN=cdf-2 PE=1 SV=2
11	AFDB:G3X931	0.353	0.138	6.541E-1	845	0.137	0.036	G3X931.pdb.gz	G3X931_MOUSE Vomeronasal 2, receptor 65 OS=Mus musculus OX=10090 GN=Vmn2r65 PE=4 SV=1
12	AFDB:Q5IRJ6	0.294	0.150	6.541E-1	567	0.137	0.053	Q5IRJ6.pdb.gz	ZNT9_MOUSE Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Mus musculus OX=10090 GN=Slc30a9 PE=1 SV=2
13	PDB:7cgpA	0.257	0.347	8.842E-1	147	0.082	0.122	7cgpA.pdb.gz
14	PDB:4jr9A	0.181	0.113	1.116	409	0.123	0.066	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.
15	PDB:6bw5D	0.232	0.171	1.225	362	0.151	0.091	6bw5D.pdb.gz	GlcNAc-1-P-transferase-tunicamycin complex structure reveals basis for inhibition of N-glycosylation.
16	PDB:6yupD	0.181	0.128	1.620	328	0.114	0.076	6yupD.pdb.gz	Structural basis for amino acid exchange by a human heteromeric amino acid transporter.
17	PDB:7c9iC	0.270	0.250	1.951	243	0.123	0.111	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
18	PDB:7b93L	0.189	0.096	2.044	607	0.142	0.051	7b93L.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
19	PDB:3nkaB	0.168	0.162	2.142	233	0.119	0.112	3nkaB.pdb.gz	Structural context shapes the aquaporin selectivity filter.
20	PDB:6vn7R	0.184	0.163	2.351	263	0.142	0.118	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07326	1.36e-158	439	219	1.000	1.000	PIGF_HUMAN Phosphatidylinositol-glycan biosynthesis class F protein OS=Homo sapiens OX=9606 GN=PIGF PE=1 SV=1
2	O09101	1.32e-140	393	219	0.877	0.877	PIGF_MOUSE Phosphatidylinositol-glycan biosynthesis class F protein OS=Mus musculus OX=10090 GN=Pigf PE=1 SV=1
3	Q5AFT2	2.25e-12	66.6	265	0.146	0.121	GPI11_CANAL Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI11 PE=3 SV=1
4	Q06636	4.33e-08	53.9	219	0.169	0.169	GPI11_YEAST Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI11 PE=1 SV=1
5	Q9U6Q2	6.5	30.0	623	0.146	0.051	Q9U6Q2_DROME Sulfate transporter OS=Drosophila melanogaster OX=7227 GN=Esp PE=2 SV=1
6	P58421	8.0	30.0	559	0.091	0.036	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06699 PIG-F	2.8e-43	159.7	GPI biosynthesis protein family Pig-F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000164305	0.963	GPI mannosyltransferase 3
2	9606.ENSP00000367880	0.946	GPI ethanolamine phosphate transferase 3
3	9606.ENSP00000415203	0.936	GPI ethanolamine phosphate transferase 2
4	9606.ENSP00000369820	0.866	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
5	9606.ENSP00000347206	0.863	Glycosylphosphatidylinositol anchor attachment 1 protein
6	9606.ENSP00000279036	0.843	GPI transamidase component PIG-T
7	9606.ENSP00000309430	0.739	GPI transamidase component PIG-S
8	9606.ENSP00000217446	0.712	Phosphatidylinositol glycan anchor biosynthesis class U protein
9	9606.ENSP00000359848	0.705	GPI-anchor transamidase
10	9606.ENSP00000350263	0.652	GPI ethanolamine phosphate transferase 1
11	9606.ENSP00000219431	0.642	DNA-3-methyladenine glycosylase
12	9606.ENSP00000413405	0.633	GPI mannosyltransferase 4
13	9606.ENSP00000363260	0.627	GPI mannosyltransferase 2
14	9606.ENSP00000357069	0.617	GPI mannosyltransferase 1
15	9606.ENSP00000420037	0.591	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
16	9606.ENSP00000225609	0.565	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
17	9606.ENSP00000296333	0.541	Phosphatidylinositol-glycan biosynthesis class X protein
18	9606.ENSP00000381567	0.539	TATA element modulatory factor
19	9606.ENSP00000387122	0.537	Protein CLEC16A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016780	1.000	phosphotransferase activity, for other substituted phosphate groups
GO:0005515	0.994	protein binding
GO:0017169	0.953	CDP-alcohol phosphatidyltransferase activity
GO:0004307	0.592	ethanolaminephosphotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044260	0.996	cellular macromolecule metabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0043412	0.995	macromolecule modification
GO:0044249	0.995	cellular biosynthetic process
GO:0019538	0.995	protein metabolic process
GO:0006506	0.993	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.
RHEA:32943	0.592	a 1,2-diacyl-sn-glycerol + CDP-ethanolamine = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CMP + H(+)
EC:2.7.8.1	0.592	ethanolaminephosphotransferase.

[back to server]