StarFunc result for job id Q07343

User Input

>input (736 residues)
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AWC9	0.898	0.898	4.694E-82	736	0.971	0.971	B1AWC9.pdb.gz	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
2	AFDB:Q01063	0.776	0.765	1.168E-63	747	0.720	0.710	Q01063.pdb.gz	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
3	AFDB:A0A140VJR0	0.712	0.650	1.586E-59	809	0.689	0.627	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
4	AFDB:O89084	0.720	0.630	1.160E-57	844	0.668	0.583	O89084.pdb.gz	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
5	AFDB:Q9W4S9	0.661	0.500	4.384E-51	983	0.561	0.420	Q9W4S9.pdb.gz	PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=2
6	AFDB:O18696	0.396	0.437	1.251E-22	664	0.234	0.259	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
7	AFDB:O60658	0.456	0.406	6.321E-22	829	0.190	0.169	O60658.pdb.gz	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
8	AFDB:Q01064	0.424	0.575	1.421E-21	536	0.198	0.272	Q01064.pdb.gz	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
9	AFDB:E9Q4S1	0.459	0.393	2.045E-21	865	0.197	0.168	E9Q4S1.pdb.gz	PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1
10	AFDB:O88502	0.419	0.375	3.067E-21	823	0.174	0.156	O88502.pdb.gz	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
11	PDB:4y86B	0.393	0.870	1.641E-18	326	0.129	0.291	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:7jsnA	0.398	0.358	8.145E-14	820	0.136	0.122	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.399	0.365	8.481E-14	807	0.135	0.123	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.370	0.840	2.976E-13	311	0.113	0.267	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:7v2yB	0.088	0.063	3.058E-1	1226	0.082	0.049	7v2yB.pdb.gz
16	PDB:4nq0A	0.109	0.236	6.873E-1	254	0.058	0.169	4nq0A.pdb.gz
17	PDB:7r6k8	0.109	0.146	1.262	458	0.075	0.120	7r6k8.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
18	PDB:6ahd1	0.093	0.077	1.314	1048	0.082	0.057	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
19	PDB:3lomA	0.145	0.277	1.425	288	0.053	0.135	3lomA.pdb.gz
20	PDB:1w27A	0.069	0.072	1.484	690	0.060	0.064	1w27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJR0	1007	809	0.673	0.612	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
2	A0A1B0GW84	1008	699	0.673	0.708	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
3	A0A1U7QDZ1	1008	804	0.673	0.616	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
4	B1AWC8	1309	659	0.851	0.950	B1AWC8_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
5	B1AWC9	1495	736	0.971	0.971	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
6	B1AWD0	1083	564	0.702	0.917	B1AWD0_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
7	B1AWD1	762	402	0.496	0.908	B1AWD1_MOUSE 3',5'-cyclic-AMP phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
8	O89084	919	844	0.632	0.551	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
9	P12252	769	1070	0.534	0.367	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
10	P14270	1007	803	0.673	0.616	PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4
11	P14644	767	536	0.503	0.690	PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2
12	P14646	1483	736	0.966	0.966	PDE4B_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Rattus norvegicus OX=10116 GN=Pde4b PE=1 SV=4
13	P27815	931	886	0.649	0.540	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
14	P54748	909	844	0.635	0.553	PDE4A_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Rattus norvegicus OX=10116 GN=Pde4a PE=1 SV=1
15	Q01063	1055	747	0.719	0.708	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
16	Q07343	1537	736	1.000	1.000	PDE4B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Homo sapiens OX=9606 GN=PDE4B PE=1 SV=1
17	Q08493	861	712	0.575	0.594	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
18	Q08499	1007	809	0.673	0.612	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2
19	Q22000	627	674	0.432	0.472	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
20	Q2V4U0	627	673	0.432	0.473	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18100 PDE4_UCR	1.7e-55	198.2	Phosphodiesterase 4 upstream conserved regions (UCR)
2	PF00233 PDEase_I	1.6e-86	301.4	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332116

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355593	0.992	Disrupted in schizophrenia 1 protein
2	9606.ENSP00000309591	0.955	cAMP-dependent protein kinase catalytic subunit alpha
3	9606.ENSP00000359719	0.947	cAMP-dependent protein kinase catalytic subunit beta
4	9606.ENSP00000366488	0.939	cAMP-dependent protein kinase catalytic subunit gamma
5	9606.ENSP00000254079	0.917	Protein phosphatase 1 regulatory subunit 1B
6	9606.ENSP00000371230	0.915	GTP:AMP phosphotransferase AK3, mitochondrial
7	9606.ENSP00000286621	0.906	Adenosine kinase
8	9606.ENSP00000485525	0.906	Adenylosuccinate lyase
9	9606.ENSP00000286648	0.902	Deoxycytidine kinase
10	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
11	9606.ENSP00000378187	0.863	Adenylate cyclase type 7
12	9606.ENSP00000294016	0.860	Adenylate cyclase type 9
13	9606.ENSP00000354238	0.839	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
14	9606.ENSP00000286355	0.836	Adenylate cyclase type 8
15	9606.ENSP00000297323	0.835	Adenylate cyclase type 1
16	9606.ENSP00000419361	0.832	Adenylate cyclase type 5
17	9606.ENSP00000342952	0.828	Adenylate cyclase type 2
18	9606.ENSP00000312126	0.822	Adenylate cyclase type 4
19	9606.ENSP00000260600	0.819	Adenylate cyclase type 3
20	9606.ENSP00000356825	0.817	Adenylate cyclase type 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004115	0.999	3',5'-cyclic-AMP phosphodiesterase activity
GO:0043015	0.998	gamma-tubulin binding
GO:0044325	0.784	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.986	cellular response to stimulus
GO:0032501	0.982	multicellular organismal process
GO:0030593	0.957	neutrophil chemotaxis
GO:0065007	0.951	biological regulation
GO:0071222	0.950	cellular response to lipopolysaccharide
GO:0050789	0.942	regulation of biological process
GO:0048872	0.910	homeostasis of number of cells
GO:0050794	0.902	regulation of cellular process
GO:0001776	0.888	leukocyte homeostasis
GO:0071466	0.873	cellular response to xenobiotic stimulus
GO:0002262	0.872	myeloid cell homeostasis
GO:0001780	0.856	neutrophil homeostasis
GO:0023052	0.540	signaling
GO:0007154	0.540	cell communication
GO:0007165	0.527	signal transduction
GO:0065009	0.332	regulation of molecular function
GO:0010646	0.322	regulation of cell communication
GO:0032879	0.313	regulation of localization
GO:0048583	0.301	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0071944	0.999	cell periphery
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0032991	0.994	protein-containing complex
GO:0005815	0.990	microtubule organizing center
GO:0042995	0.975	cell projection
GO:0120025	0.973	plasma membrane bounded cell projection
GO:0005813	0.973	centrosome
GO:0045202	0.963	synapse
GO:0012505	0.956	endomembrane system
GO:0031982	0.946	vesicle
GO:0036477	0.939	somatodendritic compartment
GO:0030425	0.930	dendrite
GO:0099572	0.929	postsynaptic specialization
GO:0014069	0.923	postsynaptic density
GO:0000930	0.923	gamma-tubulin complex
GO:0031410	0.916	cytoplasmic vesicle
GO:0043197	0.915	dendritic spine
GO:0099503	0.910	secretory vesicle
GO:0060076	0.909	excitatory synapse
GO:0030133	0.897	transport vesicle
GO:0098793	0.893	presynapse
GO:0005886	0.883	plasma membrane
GO:0008021	0.867	synaptic vesicle
GO:0005634	0.734	nucleus
GO:1902495	0.312	transmembrane transporter complex
GO:0034703	0.300	cation channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	0.999	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.999	3',5'-cyclic-AMP phosphodiesterase.

[back to server]