StarFunc result for job id Q07352

User Input

>input (338 residues)
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17431	0.337	0.337	1.062E-49	338	0.985	0.985	P17431.pdb.gz	TISB_RAT mRNA decay activator protein ZFP36L1 OS=Rattus norvegicus OX=10116 GN=Zfp36l1 PE=1 SV=1
2	AFDB:Q5ISE2	0.205	0.097	5.489E-12	725	0.272	0.127	Q5ISE2.pdb.gz	Z36L3_MOUSE mRNA decay activator protein ZFP36L3 OS=Mus musculus OX=10090 GN=Zfp36l3 PE=1 SV=1
3	PDB:6dnhC	0.090	0.223	1.236E-1	117	0.053	0.154	6dnhC.pdb.gz	Molecular basis for the recognition of the human AAUAAA polyadenylation signal.
4	PDB:7dvqM	0.069	0.119	1.732E-1	191	0.041	0.073	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
5	PDB:5gm6a	0.067	0.181	2.596E-1	123	0.044	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
6	PDB:6ff4t	0.072	0.137	3.637E-1	172	0.062	0.122	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
7	PDB:6eojB	0.077	0.234	7.641E-1	94	0.038	0.138	6eojB.pdb.gz	Architecture of eukaryotic mRNA 3'-end processing machinery.
8	AFDB:P42944	0.095	0.068	9.817E-1	551	0.178	0.109	P42944.pdb.gz	GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GZF3 PE=1 SV=1
9	AFDB:Q9S7T7	0.076	0.052	1.050	627	0.154	0.083	Q9S7T7.pdb.gz	SCC11_ARATH Sister chromatid cohesion 1 protein 1 OS=Arabidopsis thaliana OX=3702 GN=SYN1 PE=2 SV=2
10	AFDB:F1R9D7	0.078	0.054	1.472	542	0.189	0.118	F1R9D7.pdb.gz
11	AFDB:Q8BMQ3	0.124	0.052	1.574	1127	0.169	0.051	Q8BMQ3.pdb.gz	BNC2_MOUSE Zinc finger protein basonuclin-2 OS=Mus musculus OX=10090 GN=Bnc2 PE=1 SV=3
12	PDB:7c06A	0.066	0.074	2.249	193	0.044	0.078	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
13	AFDB:A0A0B4J203	0.098	0.053	2.360	849	0.148	0.059	A0A0B4J203.pdb.gz	A0A0B4J203_HUMAN Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 PE=3 SV=1
14	AFDB:Q1XG89	0.072	0.021	2.525	1759	0.112	0.022	Q1XG89.pdb.gz	TDR12_BOMMO Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2
15	AFDB:Q54GR0	0.089	0.031	2.525	1036	0.124	0.041	Q54GR0.pdb.gz	Q54GR0_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289987 PE=4 SV=1
16	PDB:4v88Ah	0.078	0.139	3.151	159	0.074	0.157	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
17	AFDB:Q9U489	0.080	0.038	3.307	1147	0.178	0.052	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
18	PDB:7abiP	0.062	0.087	4.128	237	0.021	0.030	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
19	PDB:3jcmI	0.059	0.058	9.276	416	0.047	0.038	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17431	0.0	670	338	0.985	0.985	TISB_RAT mRNA decay activator protein ZFP36L1 OS=Rattus norvegicus OX=10116 GN=Zfp36l1 PE=1 SV=1
2	P23950	0.0	671	338	0.985	0.985	TISB_MOUSE mRNA decay activator protein ZFP36L1 OS=Mus musculus OX=10090 GN=Zfp36l1 PE=1 SV=1
3	Q07352	0.0	680	338	1.000	1.000	TISB_HUMAN mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1
4	Q805B4	2.11e-96	291	364	0.609	0.566	TISDB_XENLA mRNA decay activator protein ZFP36L2-B OS=Xenopus laevis OX=8355 GN=zfp36l2-B PE=1 SV=1
5	Q7ZXW9	5.03e-95	288	363	0.598	0.556	TISDA_XENLA mRNA decay activator protein ZFP36L2-A OS=Xenopus laevis OX=8355 GN=zfp36l2-A PE=1 SV=1
6	P23949	1.15e-58	198	484	0.385	0.269	TISD_MOUSE mRNA decay activator protein ZFP36L2 OS=Mus musculus OX=10090 GN=Zfp36l2 PE=1 SV=2
7	P47974	4.79e-55	189	494	0.379	0.259	TISD_HUMAN mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3
8	P47980	4.57e-39	145	436	0.186	0.144	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
9	Q5ISE2	1.07e-35	139	725	0.166	0.077	Z36L3_MOUSE mRNA decay activator protein ZFP36L3 OS=Mus musculus OX=10090 GN=Zfp36l3 PE=1 SV=1
10	P26651	3.46e-31	122	326	0.175	0.181	TTP_HUMAN mRNA decay activator protein ZFP36 OS=Homo sapiens OX=9606 GN=ZFP36 PE=1 SV=1
11	P22893	7.63e-31	120	319	0.169	0.179	TTP_MOUSE mRNA decay activator protein ZFP36 OS=Mus musculus OX=10090 GN=Zfp36 PE=1 SV=1
12	P47973	2.18e-30	119	320	0.172	0.181	TTP_RAT mRNA decay activator protein ZFP36 OS=Rattus norvegicus OX=10116 GN=Zfp36 PE=1 SV=1
13	Q54MG5	1.42e-28	116	437	0.145	0.112	Q54MG5_DICDI C3H1-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285973 PE=4 SV=2
14	Q7YXD9	1.37e-26	110	419	0.127	0.103	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1
15	Q20155	1.49e-26	111	460	0.127	0.093	Q20155_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=4 SV=3
16	Q9C9F5	2.57e-23	100	308	0.127	0.140	C3H15_ARATH Zinc finger CCCH domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=C3H15 PE=1 SV=1
17	Q9C9N3	3.12e-23	99.8	310	0.121	0.132	C3H14_ARATH Zinc finger CCCH domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=C3H14 PE=2 SV=1
18	P47979	1.57e-21	96.7	404	0.112	0.094	ZFS1_SCHPO Zinc finger protein zfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zfs1 PE=1 SV=1
19	P47976	2.06e-18	86.7	325	0.104	0.108	CTH1_YEAST mRNA decay factor CTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTH1 PE=1 SV=2
20	G5EF15	8.61e-18	84.0	264	0.107	0.136	POS1_CAEEL RNA-binding protein pos-1 OS=Caenorhabditis elegans OX=6239 GN=pos-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04553 Tis11B_N	6.4e-27	106.0	Tis11B like protein, N terminus
2	PF16131 Torus	4.8	19.3	Torus domain
3	PF00642 zf-CCCH	4.2e-19	79.3	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
4	PF14608 zf-CCCH_2	0.018	26.8	RNA-binding, Nab2-type zinc finger
5	PF18044 zf-CCCH_4	0.00031	31.7	CCCH-type zinc finger
6	PF18345 zf_CCCH_4	3.4e-08	44.5	Zinc finger domain
7	PF19242 Zn_finger_prot	9.4e+02	10.9	Putative zinc finger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356070	0.965	MAP kinase-activated protein kinase 2
2	9606.ENSP00000451828	0.940	RAC-alpha serine/threonine-protein kinase
3	9606.ENSP00000373715	0.909	m7GpppN-mRNA hydrolase
4	9606.ENSP00000282388	0.829	mRNA decay activator protein ZFP36L2
5	9606.ENSP00000476046	0.826	mRNA-decapping enzyme 1A
6	9606.ENSP00000264951	0.804	5'-3' exoribonuclease 1
7	9606.ENSP00000229795	0.769	Mitogen-activated protein kinase 14
8	9606.ENSP00000470142	0.753	Regulator of nonsense transcripts 1
9	9606.ENSP00000320949	0.750	CCR4-NOT transcription complex subunit 1
10	9606.ENSP00000361433	0.745	Exosome complex component RRP4
11	9606.ENSP00000361930	0.740	14-3-3 protein beta/alpha
12	9606.ENSP00000359939	0.735	Exosome complex component CSL4
13	9606.ENSP00000313199	0.693	Heterogeneous nuclear ribonucleoprotein D0
14	9606.ENSP00000221233	0.653	Exosome complex component RRP46
15	9606.ENSP00000366997	0.649	Exosome complex exonuclease RRP44
16	9606.ENSP00000323046	0.648	Exosome complex component RRP40
17	9606.ENSP00000398597	0.648	Exosome complex component MTR3
18	9606.ENSP00000265564	0.645	Exosome complex component RRP42
19	9606.ENSP00000374354	0.641	Exosome complex component RRP43
20	9606.ENSP00000315476	0.632	Exosome complex component RRP41

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035925	1.000	mRNA 3'-UTR AU-rich region binding
GO:0005515	0.969	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.992	regulation of gene expression
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0048519	0.988	negative regulation of biological process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0009892	0.977	negative regulation of metabolic process
GO:0048522	0.975	positive regulation of cellular process
GO:0010556	0.974	regulation of macromolecule biosynthetic process
GO:0031326	0.974	regulation of cellular biosynthetic process
GO:0010605	0.974	negative regulation of macromolecule metabolic process
GO:1903313	0.971	positive regulation of mRNA metabolic process
GO:0031331	0.970	positive regulation of cellular catabolic process
GO:0051246	0.967	regulation of protein metabolic process
GO:0034248	0.964	regulation of amide metabolic process
GO:2000112	0.962	regulation of cellular macromolecule biosynthetic process
GO:0043488	0.959	regulation of mRNA stability
GO:0010629	0.957	negative regulation of gene expression
GO:0061014	0.955	positive regulation of mRNA catabolic process
GO:0006807	0.953	nitrogen compound metabolic process
GO:0006417	0.945	regulation of translation
GO:0006401	0.918	RNA catabolic process
GO:0016071	0.887	mRNA metabolic process
GO:0048523	0.869	negative regulation of cellular process
GO:0006402	0.853	mRNA catabolic process
GO:0000956	0.808	nuclear-transcribed mRNA catabolic process
GO:0031324	0.793	negative regulation of cellular metabolic process
GO:0051172	0.779	negative regulation of nitrogen compound metabolic process
GO:0010558	0.674	negative regulation of macromolecule biosynthetic process
GO:0031327	0.669	negative regulation of cellular biosynthetic process
GO:0050896	0.561	response to stimulus
GO:0051248	0.543	negative regulation of protein metabolic process
GO:0017148	0.457	negative regulation of translation
GO:0050779	0.415	RNA destabilization
GO:0061157	0.410	mRNA destabilization
GO:0051716	0.358	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.996	cytosol
GO:0032991	0.992	protein-containing complex
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:1990904	0.613	ribonucleoprotein complex
GO:0043233	0.550	organelle lumen
GO:0031981	0.535	nuclear lumen
GO:0005654	0.513	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]