StarFunc result for job id Q07444

User Input

>input (240 residues)
MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLQACASKNSSSLLCIDNEEEMKFLASILPSSWIGVFRNS
SHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07444	1.000	1.000	4.036E-46	240	1.000	1.000	Q07444.pdb.gz	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
2	AFDB:P26717	0.506	0.524	1.072E-34	231	0.871	0.905	P26717.pdb.gz	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
3	AFDB:P26715	0.480	0.494	2.348E-27	233	0.675	0.695	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
4	AFDB:A6H5Z4	0.478	0.470	1.192E-20	244	0.421	0.414	A6H5Z4.pdb.gz	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	AFDB:A1L3Q6	0.478	0.467	2.815E-18	246	0.338	0.329	A1L3Q6.pdb.gz	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
6	AFDB:D3YXP2	0.473	0.512	2.602E-17	221	0.325	0.353	D3YXP2.pdb.gz	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
7	AFDB:E9QAJ6	0.473	0.537	2.118E-16	210	0.350	0.400	E9QAJ6.pdb.gz	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
8	AFDB:Q80ZC8	0.480	0.506	7.803E-14	226	0.217	0.230	Q80ZC8.pdb.gz	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
9	AFDB:Q96E93	0.450	0.547	4.623E-13	195	0.192	0.236	Q96E93.pdb.gz	KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 OS=Homo sapiens OX=9606 GN=KLRG1 PE=1 SV=1
10	AFDB:P27812	0.455	0.488	7.213E-13	223	0.188	0.202	P27812.pdb.gz	KRBBA_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele A OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
11	PDB:1qddA	0.438	0.697	7.900E-8	144	0.125	0.208	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
12	PDB:7wz8A	0.424	0.553	1.313E-7	180	0.129	0.172	7wz8A.pdb.gz
13	PDB:1htnA	0.436	0.649	3.000E-7	156	0.096	0.147	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
14	PDB:7qsrA	0.413	0.080	2.151E-6	1335	0.133	0.024	7qsrA.pdb.gz
15	PDB:4mthA	0.419	0.685	2.773E-6	139	0.092	0.158	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
16	PDB:1gz2A	0.398	0.644	4.912E-6	139	0.096	0.165	1gz2A.pdb.gz
17	PDB:5f2qB	0.406	0.675	7.192E-6	135	0.104	0.185	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
18	PDB:1bj3A	0.367	0.655	1.358E-5	129	0.104	0.194	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
19	PDB:1bj3B	0.313	0.571	1.542E-5	123	0.087	0.171	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:3bx4C	0.361	0.615	1.643E-5	134	0.117	0.209	3bx4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07444	0.0	499	240	1.000	1.000	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
2	P26717	6.51e-150	418	231	0.858	0.892	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
3	P26715	3.54e-108	313	233	0.671	0.691	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
4	Q9WU32	3.47e-53	173	227	0.412	0.436	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	Q9WU31	6.11e-53	173	244	0.425	0.418	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
6	Q9Z202	6.45e-53	173	244	0.429	0.422	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
7	A6H5Z4	1.32e-51	169	244	0.425	0.418	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
8	E9QAJ6	6.61e-40	138	210	0.346	0.395	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
9	Q9WVJ8	1.43e-39	137	210	0.346	0.395	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
10	Q9WTJ9	3.35e-39	137	238	0.308	0.311	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
11	Q9QXN7	5.69e-39	136	221	0.321	0.348	Q9QXN7_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
12	D3YXP2	6.14e-39	136	221	0.312	0.339	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
13	A1L3Q6	6.84e-39	137	246	0.338	0.329	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
14	Q9WVJ7	4.29e-36	129	213	0.300	0.338	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
15	L7N477	6.31e-36	128	213	0.304	0.343	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
16	Q8CB89	1.35e-31	117	206	0.254	0.296	Q8CB89_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
17	Q13241	1.24e-18	82.4	179	0.217	0.291	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
18	Q80ZC8	1.70e-18	83.2	226	0.188	0.199	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
19	Q8CJC7	2.45e-16	77.4	226	0.221	0.235	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
20	Q5DT39	1.43e-12	67.4	243	0.246	0.243	KLRI1_RAT Killer cell lectin-like receptor subfamily I member 1 OS=Rattus norvegicus OX=10116 GN=Klri1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	27	15.5	Chordopoxvirus A33R protein
2	PF00059 Lectin_C	0.00015	33.8	Lectin C-type domain
3	PF05473 UL45	0.33	22.1	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365817	0.938	HLA class I histocompatibility antigen, alpha chain E
2	9606.ENSP00000262629	0.879	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000375608	0.859	Killer cell immunoglobulin-like receptor 3DL1
4	9606.ENSP00000336769	0.858	Killer cell immunoglobulin-like receptor 2DL1
5	9606.ENSP00000342215	0.858	Killer cell immunoglobulin-like receptor 2DL3
6	9606.ENSP00000371333	0.847	Natural killer cells antigen CD94
7	9606.ENSP00000325525	0.845	Killer cell immunoglobulin-like receptor 3DL2
8	9606.ENSP00000291860	0.811	Killer cell immunoglobulin-like receptor 3DL3
9	9606.ENSP00000438038	0.805	NKG2-A/NKG2-B type II integral membrane protein
10	9606.ENSP00000310216	0.804	NKG2-F type II integral membrane protein
11	9606.ENSP00000371327	0.802	NKG2-C type II integral membrane protein
12	9606.ENSP00000365402	0.699	HLA class I histocompatibility antigen, Cw-7 alpha chain
13	9606.ENSP00000379873	0.699	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000412927	0.691	HLA class I histocompatibility antigen, alpha chain G
15	9606.ENSP00000399168	0.683	HLA class I histocompatibility antigen, B-7 alpha chain
16	9606.ENSP00000259951	0.663	HLA class I histocompatibility antigen, alpha chain F
17	9606.ENSP00000329318	0.573	Transmembrane protein 121B
18	9606.ENSP00000480132	0.504	Neural cell adhesion molecule 1
19	9606.ENSP00000483713	0.500	Killer cell lectin-like receptor subfamily F member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0044877	0.644	protein-containing complex binding
GO:0003823	0.591	antigen binding
GO:0042802	0.398	identical protein binding
GO:0032394	0.314	MHC class Ib receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.979	regulation of cellular process
GO:0009987	0.949	cellular process
GO:0006950	0.945	response to stress
GO:0006952	0.936	defense response
GO:0006968	0.928	cellular defense response
GO:0002682	0.895	regulation of immune system process
GO:0048583	0.876	regulation of response to stimulus
GO:0050776	0.857	regulation of immune response
GO:0002376	0.848	immune system process
GO:0051716	0.844	cellular response to stimulus
GO:0045088	0.686	regulation of innate immune response
GO:0007165	0.660	signal transduction
GO:0048518	0.644	positive regulation of biological process
GO:0002706	0.627	regulation of lymphocyte mediated immunity
GO:0002684	0.585	positive regulation of immune system process
GO:0048584	0.582	positive regulation of response to stimulus
GO:0048522	0.575	positive regulation of cellular process
GO:0042269	0.557	regulation of natural killer cell mediated cytotoxicity
GO:0050778	0.556	positive regulation of immune response
GO:0007166	0.531	cell surface receptor signaling pathway
GO:0002768	0.503	immune response-regulating cell surface receptor signaling pathway
GO:0002705	0.496	positive regulation of leukocyte mediated immunity
GO:0002708	0.494	positive regulation of lymphocyte mediated immunity
GO:0045089	0.488	positive regulation of innate immune response
GO:0001912	0.487	positive regulation of leukocyte mediated cytotoxicity
GO:0048519	0.484	negative regulation of biological process
GO:0051239	0.467	regulation of multicellular organismal process
GO:0048523	0.450	negative regulation of cellular process
GO:0002717	0.436	positive regulation of natural killer cell mediated immunity
GO:0050865	0.408	regulation of cell activation
GO:0002683	0.406	negative regulation of immune system process
GO:0002694	0.398	regulation of leukocyte activation
GO:0006955	0.385	immune response
GO:0045954	0.385	positive regulation of natural killer cell mediated cytotoxicity
GO:0051249	0.384	regulation of lymphocyte activation
GO:0002822	0.350	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032501	0.343	multicellular organismal process
GO:0002704	0.333	negative regulation of leukocyte mediated immunity
GO:0009607	0.328	response to biotic stimulus
GO:0002757	0.320	immune response-activating signaling pathway
GO:0001911	0.314	negative regulation of leukocyte mediated cytotoxicity
GO:0002707	0.312	negative regulation of lymphocyte mediated immunity
GO:0002429	0.300	immune response-activating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.987	protein-containing complex
GO:0009986	0.889	cell surface
GO:0098552	0.843	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]