StarFunc result for job id Q07507

User Input

>input (201 residues)
MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVR
SIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYF
ESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVER
DRQWKFIMCRMTEYDCEFANV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07507	1.000	1.000	1.884E-39	201	1.000	1.000	Q07507.pdb.gz	DERM_HUMAN Dermatopontin OS=Homo sapiens OX=9606 GN=DPT PE=1 SV=2
2	PDB:6vlsD	0.279	0.072	2.676E-2	963	0.070	0.015	6vlsD.pdb.gz
3	AFDB:Q94128	0.337	0.164	4.717E-2	485	0.144	0.060	Q94128.pdb.gz	WRT1_CAEEL Warthog protein 1 OS=Caenorhabditis elegans OX=6239 GN=wrt-1 PE=2 SV=1
4	AFDB:O16267	0.151	0.139	4.969E-2	186	0.109	0.118	O16267.pdb.gz	O16267_CAEEL Conserved secreted protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F40A3.1 PE=4 SV=2
5	AFDB:L7N1X9	0.194	0.217	5.514E-2	171	0.134	0.158	L7N1X9.pdb.gz	L7N1X9_MOUSE Demilune cell and parotid protein 1 OS=Mus musculus OX=10090 GN=Dcpp1 PE=1 SV=1
6	AFDB:Q94129	0.361	0.159	9.776E-2	557	0.090	0.032	Q94129.pdb.gz	WRT4_CAEEL Warthog protein 4 OS=Caenorhabditis elegans OX=6239 GN=wrt-4 PE=2 SV=2
7	PDB:6u3xB	0.379	0.191	1.091E-1	486	0.124	0.051	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
8	AFDB:Q4FZY1	0.144	0.105	1.408E-1	330	0.114	0.070	Q4FZY1.pdb.gz	Q4FZY1_RAT Cd68 molecule OS=Rattus norvegicus OX=10116 GN=Cd68 PE=1 SV=1
9	PDB:3o2yA	0.148	0.171	1.492E-1	160	0.075	0.094	3o2yA.pdb.gz
10	PDB:5hhmI	0.118	0.120	1.935E-1	196	0.070	0.071	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
11	AFDB:Q9V9S0	0.149	0.119	3.238E-1	318	0.075	0.047	Q9V9S0.pdb.gz	Q9V9S0_DROME FI04419p OS=Drosophila melanogaster OX=7227 GN=Lamp1 PE=1 SV=3
12	AFDB:P41366	0.160	0.169	3.785E-1	183	0.109	0.120	P41366.pdb.gz	VMO1_CHICK Vitelline membrane outer layer protein 1 OS=Gallus gallus OX=9031 GN=VMO1 PE=1 SV=1
13	PDB:6k2zA	0.131	0.172	3.808E-1	138	0.070	0.101	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
14	PDB:8a9kD	0.133	0.102	4.451E-1	285	0.045	0.032	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	AFDB:Q7Z5L0	0.226	0.225	4.661E-1	202	0.109	0.109	Q7Z5L0.pdb.gz	VMO1_HUMAN Vitelline membrane outer layer protein 1 homolog OS=Homo sapiens OX=9606 GN=VMO1 PE=1 SV=1
16	PDB:3apxA	0.121	0.125	4.940E-1	179	0.070	0.078	3apxA.pdb.gz	Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
17	AFDB:Q9VMV5	0.143	0.029	5.173E-1	1940	0.144	0.015	Q9VMV5.pdb.gz	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
18	PDB:1bd2D	0.125	0.130	5.775E-1	190	0.090	0.095	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
19	PDB:5lkhA	0.118	0.037	6.751E-1	948	0.070	0.015	5lkhA.pdb.gz
20	PDB:3j81k	0.100	0.068	7.112E-1	365	0.060	0.033	3j81k.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07507	2.65e-152	421	201	1.000	1.000	DERM_HUMAN Dermatopontin OS=Homo sapiens OX=9606 GN=DPT PE=1 SV=2
2	P45846	1.52e-134	376	183	0.876	0.962	DERM_PIG Dermatopontin OS=Sus scrofa OX=9823 GN=DPT PE=1 SV=2
3	Q9QZZ6	2.07e-118	336	201	0.776	0.776	DERM_MOUSE Dermatopontin OS=Mus musculus OX=10090 GN=Dpt PE=1 SV=1
4	F4J117	1.7	32.0	591	0.095	0.032	LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSF1 PE=1 SV=1
5	Q5G1T8	6.8	29.6	284	0.090	0.063	Q5G1T8_ONCMY Phosphotransferase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=HK1 PE=2 SV=1
6	P45387	8.5	29.6	1394	0.070	0.010	HAP2_HAEIF Adhesion and penetration protein autotransporter OS=Haemophilus influenzae OX=727 GN=hap PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14704 DERM	7.5e-34	128.8	Dermatopontin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018158

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006808	0.737	Decorin
2	61853.ENSNLEP00000016605	0.585	Alanine-glyoxylate aminotransferase
3	61853.ENSNLEP00000003188	0.545	F-box and leucine-rich repeat protein 14
4	61853.ENSNLEP00000003482	0.538	Cytochrome c oxidase subunit VIc
5	61853.ENSNLEP00000013007	0.532	Cyclin B1 interacting protein 1, E3 ubiquitin protein ligase
6	61853.ENSNLEP00000005282	0.531	Epithelial membrane protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0030198	0.967	extracellular matrix organization
GO:0048523	0.961	negative regulation of cellular process
GO:0042127	0.959	regulation of cell population proliferation
GO:0030199	0.897	collagen fibril organization
GO:0008285	0.841	negative regulation of cell population proliferation
GO:0032501	0.356	multicellular organismal process
GO:0048856	0.355	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005576	0.995	extracellular region
GO:0005615	0.988	extracellular space
GO:0043227	0.730	membrane-bounded organelle
GO:0043233	0.588	organelle lumen
GO:0070013	0.577	intracellular organelle lumen
GO:0031982	0.496	vesicle
GO:0005737	0.476	cytoplasm
GO:0043231	0.464	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]