StarFunc result for job id Q07666

User Input

>input (443 residues)
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPA
TQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPP
PAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07666	1.000	1.000	3.313E-67	443	1.000	1.000	Q07666.pdb.gz	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
2	AFDB:Q6NW62	0.413	0.510	2.142E-39	352	0.535	0.673	Q6NW62.pdb.gz	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
3	AFDB:O44433	0.332	0.345	5.060E-21	425	0.269	0.280	O44433.pdb.gz	O44433_DROME QKR54B OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=2 SV=1
4	AFDB:Q9W224	0.323	0.411	2.462E-19	340	0.176	0.229	Q9W224.pdb.gz	Q9W224_DROME Novel spermatogenesis regulator, isoform A OS=Drosophila melanogaster OX=7227 GN=nsr PE=4 SV=2
5	AFDB:Q32NN2	0.288	0.370	1.832E-17	341	0.253	0.328	Q32NN2.pdb.gz	QKIA_XENLA KH domain-containing RNA-binding protein qki.S OS=Xenopus laevis OX=8355 GN=qki.S PE=1 SV=2
6	AFDB:G5EFF1	0.286	0.285	1.132E-16	445	0.214	0.213	G5EFF1.pdb.gz	ASD2_CAEEL RNA-binding protein asd-2 OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=1
7	AFDB:Q69Z36	0.141	0.107	5.092E-4	601	0.160	0.118	Q69Z36.pdb.gz	MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus OX=10090 GN=Mex3b PE=2 SV=2
8	AFDB:A0A0A0MQZ8	0.127	0.076	1.613E-3	866	0.129	0.066	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
9	PDB:6zqbJO	0.147	0.256	7.861E-3	236	0.061	0.114	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
10	PDB:7mqaSW	0.160	0.310	1.065E-2	195	0.061	0.138	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:6ke6RC	0.143	0.217	1.629E-2	278	0.045	0.072	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
12	AFDB:Q8L7W1	0.123	0.086	2.797E-2	678	0.108	0.071	Q8L7W1.pdb.gz	MSL3_ARATH Mechanosensitive ion channel protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSL3 PE=1 SV=1
13	AFDB:Q4GZ77	0.096	0.074	6.157E-2	663	0.117	0.078	Q4GZ77.pdb.gz	Q4GZ77_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1420 PE=4 SV=1
14	PDB:7ajuJJ	0.143	0.291	6.990E-2	199	0.038	0.085	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mq8NY	0.149	0.229	1.737E-1	274	0.065	0.106	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7fbyA	0.099	0.220	2.084E-1	153	0.047	0.137	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:6zydA	0.124	0.159	4.064E-1	323	0.034	0.046	6zydA.pdb.gz
18	PDB:7azyb	0.096	0.147	4.064E-1	233	0.054	0.103	7azyb.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
19	PDB:3cw2C	0.114	0.175	5.504E-1	266	0.029	0.049	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
20	PDB:3ezeB	0.102	0.298	6.604E-1	85	0.027	0.141	3ezeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07666	0.0	889	443	1.000	1.000	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
2	Q60749	0.0	731	443	0.944	0.944	KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus OX=10090 GN=Khdrbs1 PE=1 SV=2
3	Q8UUW7	0.0	565	433	0.774	0.792	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
4	Q91V33	0.0	730	443	0.944	0.944	KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1
5	Q5VWX1	4.63e-132	386	349	0.494	0.628	KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1
6	Q6NW62	7.59e-132	385	352	0.497	0.625	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
7	Q9WU01	3.85e-130	381	349	0.494	0.628	KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus OX=10090 GN=Khdrbs2 PE=1 SV=1
8	Q920F3	7.02e-123	363	349	0.499	0.633	KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Khdrbs2 PE=1 SV=1
9	O75525	1.58e-122	362	346	0.467	0.598	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
10	Q9JLP1	1.62e-121	359	346	0.460	0.590	KHDR3_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Khdrbs3 PE=1 SV=1
11	Q9R226	2.67e-121	358	346	0.460	0.590	KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus OX=10090 GN=Khdrbs3 PE=1 SV=1
12	Q6NW56	5.62e-114	341	370	0.467	0.559	Q6NW56_DANRE KH domain containing, RNA binding, signal transduction associated 1 OS=Danio rerio OX=7955 GN=khdrbs1 PE=1 SV=1
13	A2CE73	2.38e-112	337	369	0.467	0.561	A2CE73_DANRE KH domain containing, RNA binding, signal transduction associated 1a isoform X1 OS=Danio rerio OX=7955 GN=fj90g10 PE=1 SV=1
14	E5RJZ9	5.78e-83	258	265	0.354	0.592	E5RJZ9_HUMAN KH RNA binding domain containing, signal transduction associated 3 (Fragment) OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
15	Q7KNS5	1.39e-57	197	428	0.271	0.280	Q7KNS5_DROME Quaking related 54B, isoform A OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
16	A0A0B4KFT9	1.58e-56	199	617	0.271	0.194	A0A0B4KFT9_DROME Quaking related 54B, isoform E OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
17	O44433	4.12e-56	193	425	0.266	0.278	O44433_DROME QKR54B OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=2 SV=1
18	A0A0B4LG88	3.59e-50	176	379	0.192	0.224	A0A0B4LG88_DROME Quaking related 58E-1, isoform D OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1
19	Q9W255	6.95e-50	176	396	0.192	0.215	Q9W255_DROME GH05812p OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1
20	A0A0B4LGB9	2.00e-49	174	357	0.192	0.238	A0A0B4LGB9_DROME Quaking related 58E-1, isoform C OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	1.9e-07	42.1	KH domain
2	PF13184 KH_5	4.8e+02	12.3	NusA-like KH domain
3	PF16274 Qua1	2.5e-29	112.1	Qua1 domain
4	PF16568 Sam68-YY	9.9e-11	53.5	Tyrosine-rich domain of Sam68

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000001850

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000012270	0.994	Tyrosine-protein kinase
2	9601.ENSPPYP00000018952	0.984	FYN proto-oncogene, Src family tyrosine kinase
3	9601.ENSPPYP00000017460	0.972	Ras GTPase-activating protein 1
4	9601.ENSPPYP00000024042	0.961	APC, WNT signaling pathway regulator
5	9601.ENSPPYP00000009686	0.952	Growth factor receptor-bound protein 2
6	9601.ENSPPYP00000010151	0.921	Tyrosine-protein kinase
7	9601.ENSPPYP00000011687	0.912	U2 snRNP auxiliary factor large subunit
8	9601.ENSPPYP00000015235	0.905	Uncharacterized protein
9	9601.ENSPPYP00000021658	0.905	Heterogeneous nuclear ribonucleoprotein K
10	9601.ENSPPYP00000023480	0.901	Uncharacterized protein
11	9601.ENSPPYP00000015810	0.884	Pongo abelii NCK adaptor protein 1 (NCK1), mRNA
12	9601.ENSPPYP00000012298	0.878	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
13	9601.ENSPPYP00000017597	0.874	Heterogeneous nuclear ribonucleoprotein K
14	9601.ENSPPYP00000012555	0.844	Protein tyrosine kinase 6
15	9601.ENSPPYP00000017890	0.833	IL2-inducible T-cell kinase
16	9601.ENSPPYP00000019858	0.832	Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved [...]
17	9601.ENSPPYP00000011486	0.829	Protein arginine methyltransferase 1
18	9601.ENSPPYP00000023686	0.829	Uncharacterized protein
19	9601.ENSPPYP00000012176	0.826	HCK proto-oncogene, Src family tyrosine kinase
20	9601.ENSPPYP00000010664	0.825	Heterogeneous nuclear ribonucleoprotein M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0042802	1.000	identical protein binding
GO:0019900	1.000	kinase binding
GO:0003723	1.000	RNA binding
GO:0017124	0.999	SH3 domain binding
GO:1990782	0.994	protein tyrosine kinase binding
GO:0035591	0.991	signaling adaptor activity
GO:0008143	0.927	poly(A) binding
GO:0042169	0.925	SH2 domain binding
GO:0008266	0.913	poly(U) RNA binding
GO:0003677	0.862	DNA binding
GO:0044877	0.426	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0050896	0.965	response to stimulus
GO:0010468	0.962	regulation of gene expression
GO:0043484	0.930	regulation of RNA splicing
GO:0051716	0.893	cellular response to stimulus
GO:1903311	0.887	regulation of mRNA metabolic process
GO:0050684	0.872	regulation of mRNA processing
GO:0023052	0.869	signaling
GO:0007154	0.856	cell communication
GO:0048024	0.853	regulation of mRNA splicing, via spliceosome
GO:0007165	0.842	signal transduction
GO:0071704	0.729	organic substance metabolic process
GO:0044238	0.706	primary metabolic process
GO:0044237	0.705	cellular metabolic process
GO:0007166	0.693	cell surface receptor signaling pathway
GO:0006807	0.685	nitrogen compound metabolic process
GO:0043170	0.673	macromolecule metabolic process
GO:0009889	0.494	regulation of biosynthetic process
GO:0031326	0.478	regulation of cellular biosynthetic process
GO:0010556	0.476	regulation of macromolecule biosynthetic process
GO:1901360	0.460	organic cyclic compound metabolic process
GO:0046483	0.445	heterocycle metabolic process
GO:0006725	0.445	cellular aromatic compound metabolic process
GO:0034641	0.445	cellular nitrogen compound metabolic process
GO:0006139	0.438	nucleobase-containing compound metabolic process
GO:0090304	0.430	nucleic acid metabolic process
GO:0010467	0.407	gene expression
GO:0048518	0.405	positive regulation of biological process
GO:0048519	0.398	negative regulation of biological process
GO:0016070	0.395	RNA metabolic process
GO:0048522	0.371	positive regulation of cellular process
GO:0006397	0.371	mRNA processing
GO:0048523	0.358	negative regulation of cellular process
GO:0010604	0.335	positive regulation of macromolecule metabolic process
GO:0000381	0.320	regulation of alternative mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0016020	0.988	membrane
GO:0005737	0.985	cytoplasm
GO:0005829	0.926	cytosol
GO:0071944	0.421	cell periphery
GO:0005886	0.403	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]