StarFunc result for job id Q07812

User Input

>input (192 residues)
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0D9S330	0.964	0.964	7.530E-25	192	0.984	0.984	A0A0D9S330.pdb.gz	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
2	PDB:2k7wA	0.829	0.829	4.418E-19	192	1.000	1.000	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
3	PDB:5w62A	0.774	0.947	2.042E-16	156	0.755	0.929	5w62A.pdb.gz
4	AFDB:Q9I9N4	0.800	0.800	2.152E-14	192	0.495	0.495	Q9I9N4.pdb.gz	Q9I9N4_DANRE BCL2-associated X, apoptosis regulator a OS=Danio rerio OX=7955 GN=bax PE=2 SV=1
5	AFDB:I3ITC2	0.770	0.752	8.389E-8	197	0.359	0.350	I3ITC2.pdb.gz	I3ITC2_DANRE Apoptosis regulator BAX-like OS=Danio rerio OX=7955 GN=LOC100004321 PE=3 SV=1
6	AFDB:F1QTZ0	0.652	0.610	1.604E-6	207	0.245	0.227	F1QTZ0.pdb.gz
7	AFDB:Q16548	0.654	0.707	9.513E-6	175	0.193	0.211	Q16548.pdb.gz	B2LA1_HUMAN Bcl-2-related protein A1 OS=Homo sapiens OX=9606 GN=BCL2A1 PE=1 SV=1
8	AFDB:O08734	0.681	0.633	1.095E-5	209	0.224	0.206	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
9	AFDB:Q16611	0.736	0.676	1.260E-5	211	0.219	0.199	Q16611.pdb.gz	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1
10	AFDB:O35425	0.641	0.583	1.384E-5	213	0.219	0.197	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
11	AFDB:Q9NGX3	0.653	0.420	1.384E-5	313	0.214	0.131	Q9NGX3.pdb.gz	Q9NGX3_DROME Bcl-2-like protein BUFFY (Fragment) OS=Drosophila melanogaster OX=7227 GN=Buffy PE=2 SV=1
12	AFDB:P53563	0.634	0.530	1.749E-5	233	0.219	0.180	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
13	PDB:1bxlA	0.620	0.654	5.274E-5	181	0.188	0.199	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
14	PDB:1o0lA	0.583	0.593	1.868E-4	188	0.203	0.207	1o0lA.pdb.gz
15	PDB:1lxlA	0.577	0.509	7.615E-4	221	0.203	0.176	1lxlA.pdb.gz
16	PDB:2b48A	0.342	0.449	2.827E-3	143	0.193	0.259	2b48A.pdb.gz
17	PDB:4wmuA	0.596	0.239	5.446E-3	516	0.203	0.076	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
18	PDB:2bidA	0.313	0.308	1.743E-1	197	0.151	0.147	2bidA.pdb.gz
19	PDB:2wssA	0.203	0.104	4.051E-1	510	0.089	0.033	2wssA.pdb.gz	The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
20	PDB:7cclC	0.334	0.405	4.449E-1	147	0.109	0.143	7cclC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07812	5.30e-140	390	192	1.000	1.000	BAX_HUMAN Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1
2	A0A0D9S330	3.25e-138	385	192	0.984	0.984	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
3	Q07813	1.26e-127	358	192	0.922	0.922	BAX_MOUSE Apoptosis regulator BAX OS=Mus musculus OX=10090 GN=Bax PE=1 SV=1
4	Q63690	5.68e-122	344	192	0.880	0.880	BAX_RAT Apoptosis regulator BAX OS=Rattus norvegicus OX=10116 GN=Bax PE=1 SV=2
5	Q9I9N4	6.19e-66	202	192	0.500	0.500	Q9I9N4_DANRE BCL2-associated X, apoptosis regulator a OS=Danio rerio OX=7955 GN=bax PE=2 SV=1
6	I3ITC2	6.80e-37	129	197	0.328	0.320	I3ITC2_DANRE Apoptosis regulator BAX-like OS=Danio rerio OX=7955 GN=LOC100004321 PE=3 SV=1
7	Q5EAR7	4.02e-18	80.5	207	0.177	0.164	Q5EAR7_DANRE BCL2 associated X, apoptosis regulator b OS=Danio rerio OX=7955 GN=zgc:112983 PE=2 SV=1
8	Q564A4	9.09e-14	69.3	228	0.193	0.162	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
9	P10417	8.48e-13	66.6	236	0.250	0.203	BCL2_MOUSE Apoptosis regulator Bcl-2 OS=Mus musculus OX=10090 GN=Bcl2 PE=1 SV=3
10	P49950	2.38e-12	65.5	236	0.208	0.169	BCL2_RAT Apoptosis regulator Bcl-2 OS=Rattus norvegicus OX=10116 GN=Bcl2 PE=1 SV=2
11	O02718	3.93e-12	64.7	229	0.182	0.153	BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
12	Q07817	5.05e-12	64.3	233	0.229	0.189	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
13	Q00709	7.79e-12	63.9	233	0.141	0.116	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
14	P10415	2.47e-11	62.8	239	0.198	0.159	BCL2_HUMAN Apoptosis regulator Bcl-2 OS=Homo sapiens OX=9606 GN=BCL2 PE=1 SV=2
15	P53563	2.55e-11	62.4	233	0.193	0.159	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
16	Q64373	2.55e-11	62.4	233	0.193	0.159	B2CL1_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
17	A0A087WT64	2.95e-10	58.9	197	0.214	0.208	A0A087WT64_HUMAN MCL1 apoptosis regulator, BCL2 family member OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=1
18	Q07820	3.41e-10	60.1	350	0.214	0.117	MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=3
19	O88996	6.08e-10	58.2	193	0.188	0.187	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
20	P70345	7.99e-10	57.8	193	0.188	0.187	B2CL2_MOUSE Bcl-2-like protein 2 OS=Mus musculus OX=10090 GN=Bcl2l2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	1.7e-21	88.1	Apoptosis regulator proteins, Bcl-2 family
2	PF06393 BID	4.1e+02	11.9	BH3 interacting domain (BID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010366919.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010379373.1	0.996	Counters the protective effect of Bcl-2.
2	61622.XP_010384652.1	0.994	Induces apoptosis and anoikis.
3	61622.XP_010387106.1	0.991	Apoptosis regulator Bcl-2
4	61622.XP_010351093.1	0.988	Bcl-2-like protein 1 isoform X1
5	61622.XP_010360822.1	0.969	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
6	61622.XP_010360689.1	0.963	Acts as a tumor suppressor in many tumor types
7	61622.XP_010374228.1	0.946	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
8	61622.XP_010386658.1	0.946	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
9	61622.XP_010353101.1	0.926	Apoptosis-inducing factor 1, mitochondrial isoform X1
10	61622.XP_010354239.1	0.922	Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP.
11	61622.XP_010357419.1	0.914	BCL2 antagonist/killer 1
12	61622.XP_010373722.1	0.882	Sirtuin 1
13	61622.XP_010375394.1	0.861	BCL2 associated agonist of cell death
14	61622.XP_010359886.1	0.853	cAMP-dependent protein kinase catalytic subunit alpha isoform X1
15	61622.XP_010361268.1	0.853	Protein kinase cAMP-activated catalytic subunit gamma
16	61622.XP_010380825.1	0.853	cAMP-dependent protein kinase catalytic subunit beta isoform X1
17	61622.XP_010371454.1	0.841	Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins
18	61622.XP_010361555.1	0.816	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
19	61622.XP_010362233.1	0.803	Belongs to the peptidase C2 family.
20	61622.XP_010380566.1	0.801	Belongs to the peptidase C2 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0042802	1.000	identical protein binding
GO:0031072	1.000	heat shock protein binding
GO:0051400	1.000	BH domain binding
GO:0044877	0.996	protein-containing complex binding
GO:0046983	0.923	protein dimerization activity
GO:0046982	0.867	protein heterodimerization activity
GO:0030544	0.787	Hsp70 protein binding
GO:0008289	0.590	lipid binding
GO:0015267	0.589	channel activity
GO:0042803	0.406	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0050789	0.957	regulation of biological process
GO:0007006	0.953	mitochondrial membrane organization
GO:0048856	0.952	anatomical structure development
GO:0042981	0.952	regulation of apoptotic process
GO:0008637	0.951	apoptotic mitochondrial changes
GO:0097190	0.947	apoptotic signaling pathway
GO:0044237	0.945	cellular metabolic process
GO:0048513	0.944	animal organ development
GO:0048731	0.941	system development
GO:0010033	0.935	response to organic substance
GO:0043065	0.934	positive regulation of apoptotic process
GO:0007548	0.931	sex differentiation
GO:0006950	0.924	response to stress
GO:0046660	0.916	female sex differentiation
GO:0061458	0.911	reproductive system development
GO:0008406	0.904	gonad development
GO:0043281	0.903	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2001242	0.898	regulation of intrinsic apoptotic signaling pathway
GO:0007420	0.896	brain development
GO:0033554	0.861	cellular response to stress
GO:2001235	0.841	positive regulation of apoptotic signaling pathway
GO:0043280	0.841	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006874	0.833	intracellular calcium ion homeostasis
GO:0046545	0.826	development of primary female sexual characteristics
GO:0008585	0.823	female gonad development
GO:0097193	0.802	intrinsic apoptotic signaling pathway
GO:1901700	0.789	response to oxygen-containing compound
GO:0001541	0.776	ovarian follicle development
GO:2001244	0.770	positive regulation of intrinsic apoptotic signaling pathway
GO:0070887	0.761	cellular response to chemical stimulus
GO:0048519	0.755	negative regulation of biological process
GO:0034976	0.747	response to endoplasmic reticulum stress
GO:1901698	0.738	response to nitrogen compound
GO:0002376	0.731	immune system process
GO:0070059	0.725	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0010821	0.716	regulation of mitochondrion organization
GO:1901214	0.711	regulation of neuron death
GO:0097191	0.702	extrinsic apoptotic signaling pathway
GO:0043523	0.698	regulation of neuron apoptotic process
GO:0071310	0.689	cellular response to organic substance
GO:0006919	0.684	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009719	0.664	response to endogenous stimulus
GO:0090199	0.661	regulation of release of cytochrome c from mitochondria
GO:0042542	0.657	response to hydrogen peroxide
GO:0065008	0.641	regulation of biological quality
GO:0010638	0.629	positive regulation of organelle organization
GO:0006810	0.626	transport
GO:0002931	0.620	response to ischemia
GO:0043393	0.618	regulation of protein binding
GO:0010243	0.614	response to organonitrogen compound
GO:0014070	0.589	response to organic cyclic compound
GO:0006839	0.587	mitochondrial transport
GO:0006974	0.573	cellular response to DNA damage stimulus
GO:0048523	0.562	negative regulation of cellular process
GO:0009314	0.549	response to radiation
GO:1901701	0.543	cellular response to oxygen-containing compound
GO:0046902	0.521	regulation of mitochondrial membrane permeability
GO:0055085	0.520	transmembrane transport
GO:0006811	0.516	monoatomic ion transport
GO:0034220	0.507	monoatomic ion transmembrane transport
GO:0097305	0.503	response to alcohol
GO:0048869	0.493	cellular developmental process
GO:0010038	0.491	response to metal ion
GO:0030154	0.479	cell differentiation
GO:0009410	0.447	response to xenobiotic stimulus
GO:0021987	0.446	cerebral cortex development
GO:0033993	0.439	response to lipid
GO:0046546	0.390	development of primary male sexual characteristics
GO:0043066	0.387	negative regulation of apoptotic process
GO:0009056	0.382	catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005741	0.998	mitochondrial outer membrane
GO:0012505	0.960	endomembrane system
GO:0032991	0.888	protein-containing complex
GO:0005783	0.541	endoplasmic reticulum
GO:0005634	0.319	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]