StarFunc result for job id Q07817

User Input

>input (233 residues)
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53563	0.944	0.944	7.481E-30	233	0.979	0.979	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
2	AFDB:O35843	0.726	0.721	7.797E-23	235	0.807	0.800	O35843.pdb.gz	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
3	PDB:1lxlA	0.621	0.651	1.665E-19	221	0.893	0.941	1lxlA.pdb.gz
4	AFDB:Q90Z98	0.770	0.754	3.846E-17	238	0.494	0.483	Q90Z98.pdb.gz	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
5	PDB:1bxlA	0.605	0.768	3.212E-15	181	0.725	0.934	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
6	AFDB:A0A024R2B3	0.675	0.659	1.801E-14	239	0.412	0.402	A0A024R2B3.pdb.gz
7	AFDB:Q00709	0.668	0.668	2.514E-14	233	0.433	0.433	Q00709.pdb.gz	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
8	AFDB:Q7TS60	0.587	0.624	2.117E-12	219	0.395	0.420	Q7TS60.pdb.gz	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
9	PDB:2b48A	0.409	0.648	4.294E-12	143	0.605	0.986	2b48A.pdb.gz
10	AFDB:Q564A4	0.651	0.664	6.042E-12	228	0.399	0.408	Q564A4.pdb.gz	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
11	AFDB:A0A0S2Z3D2	0.379	0.574	2.488E-10	151	0.536	0.828	A0A0S2Z3D2.pdb.gz	A0A0S2Z3D2_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
12	PDB:4hnjB	0.356	0.620	3.286E-10	130	0.545	0.977	4hnjB.pdb.gz	PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
13	PDB:1o0lA	0.598	0.726	2.727E-7	188	0.378	0.468	1o0lA.pdb.gz
14	AFDB:O08734	0.504	0.555	5.280E-6	209	0.236	0.263	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
15	AFDB:F1QTZ0	0.474	0.524	6.092E-6	207	0.206	0.232	F1QTZ0.pdb.gz
16	PDB:2k7wA	0.427	0.505	1.783E-4	192	0.163	0.198	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
17	PDB:5w62A	0.408	0.586	2.158E-4	156	0.146	0.218	5w62A.pdb.gz
18	PDB:4wmuA	0.445	0.209	1.998E-2	516	0.137	0.062	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
19	PDB:1ddbA	0.303	0.341	5.359E-1	195	0.112	0.133	1ddbA.pdb.gz
20	PDB:2bidA	0.348	0.396	7.482E-1	197	0.094	0.112	2bidA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07817	4.36e-175	482	233	1.000	1.000	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
2	Q64373	3.48e-171	472	233	0.979	0.979	B2CL1_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
3	P53563	7.26e-171	471	233	0.979	0.979	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
4	O35843	1.13e-135	382	235	0.790	0.783	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
5	A0A0S2Z3D2	6.13e-89	261	151	0.536	0.828	A0A0S2Z3D2_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
6	Q90Z98	1.82e-79	240	238	0.545	0.534	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
7	Q00709	1.16e-58	187	233	0.438	0.438	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
8	P49950	1.93e-56	181	236	0.421	0.415	BCL2_RAT Apoptosis regulator Bcl-2 OS=Rattus norvegicus OX=10116 GN=Bcl2 PE=1 SV=2
9	P10417	1.30e-55	179	236	0.421	0.415	BCL2_MOUSE Apoptosis regulator Bcl-2 OS=Mus musculus OX=10090 GN=Bcl2 PE=1 SV=3
10	P10415	9.98e-54	174	239	0.421	0.410	BCL2_HUMAN Apoptosis regulator Bcl-2 OS=Homo sapiens OX=9606 GN=BCL2 PE=1 SV=2
11	Q564A4	4.96e-51	167	228	0.386	0.395	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
12	O02718	6.63e-51	167	229	0.382	0.389	BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
13	O88996	4.66e-50	164	193	0.395	0.477	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
14	Q7TS60	1.11e-49	163	219	0.395	0.420	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
15	Q92843	1.41e-49	162	193	0.391	0.472	B2CL2_HUMAN Bcl-2-like protein 2 OS=Homo sapiens OX=9606 GN=BCL2L2 PE=1 SV=2
16	P70345	2.73e-49	161	193	0.391	0.472	B2CL2_MOUSE Bcl-2-like protein 2 OS=Mus musculus OX=10090 GN=Bcl2l2 PE=1 SV=1
17	O08734	7.21e-16	75.5	209	0.193	0.215	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
18	F7EQF3	1.44e-14	72.0	208	0.146	0.163	F7EQF3_RAT BCL2-antagonist/killer 1 OS=Rattus norvegicus OX=10116 GN=Bak1 PE=3 SV=1
19	Q9I9N4	4.05e-13	67.8	192	0.176	0.214	Q9I9N4_DANRE BCL2-associated X, apoptosis regulator a OS=Danio rerio OX=7955 GN=bax PE=2 SV=1
20	Q63690	6.02e-13	67.4	192	0.146	0.177	BAX_RAT Apoptosis regulator BAX OS=Rattus norvegicus OX=10116 GN=Bax PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	2.3e-27	106.9	Apoptosis regulator proteins, Bcl-2 family
2	PF15286 Bcl-2_3	66	15.6	Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like
3	PF02180 BH4	3e-11	54.2	Bcl-2 homology region 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000010478

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000034035	0.997	BCL2-associated agonist of cell death
2	9612.ENSCAFP00000024579	0.996	Acts as a tumor suppressor in many tumor types
3	9612.ENSCAFP00000037767	0.996	Bcl-2-like protein 11
4	9612.ENSCAFP00000001448	0.995	BCL2-antagonist/killer 1
5	9612.ENSCAFP00000004225	0.988	Cytochrome c
6	9612.ENSCAFP00000023833	0.987	Uncharacterized protein
7	9612.ENSCAFP00000032282	0.979	Phorbol-12-myristate-13-acetate-induced protein 1
8	9612.ENSCAFP00000001311	0.970	BCL2-interacting killer (apoptosis-inducing)
9	9612.ENSCAFP00000023241	0.962	V-akt murine thymoma viral oncogene homolog 3
10	9612.ENSCAFP00000027133	0.962	V-akt murine thymoma viral oncogene homolog 1
11	9612.ENSCAFP00000009806	0.960	Apoptotic protease-activating factor 1
12	9612.ENSCAFP00000033658	0.959	BCL2/adenovirus E1B 19kDa interacting protein 3
13	9612.ENSCAFP00000009198	0.952	PGAM family member 5, mitochondrial serine/threonine protein phosphatase
14	9612.ENSCAFP00000022816	0.952	NLR family, pyrin domain containing 1
15	9612.ENSCAFP00000005763	0.946	BCL2 associated X, apoptosis regulator
16	9612.ENSCAFP00000013847	0.946	Mitogen-activated protein kinase 10
17	9612.ENSCAFP00000008032	0.944	V-akt murine thymoma viral oncogene homolog 2
18	9612.ENSCAFP00000032278	0.942	Parkinsonism associated deglycase
19	9612.ENSCAFP00000009756	0.941	KRAS proto-oncogene, GTPase
20	9612.ENSCAFP00000022173	0.940	PTEN induced putative kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051400	0.998	BH domain binding
GO:0019899	0.997	enzyme binding
GO:0030234	0.937	enzyme regulator activity
GO:0140678	0.882	molecular function inhibitor activity
GO:0044877	0.819	protein-containing complex binding
GO:0042802	0.694	identical protein binding
GO:0043028	0.528	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0043027	0.494	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0051020	0.436	GTPase binding
GO:0030276	0.428	clathrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.988	cellular response to stimulus
GO:0048519	0.985	negative regulation of biological process
GO:0042981	0.985	regulation of apoptotic process
GO:0023052	0.979	signaling
GO:0043066	0.979	negative regulation of apoptotic process
GO:0007154	0.977	cell communication
GO:0019222	0.975	regulation of metabolic process
GO:0042221	0.972	response to chemical
GO:0048522	0.968	positive regulation of cellular process
GO:2001233	0.959	regulation of apoptotic signaling pathway
GO:0016043	0.958	cellular component organization
GO:0071310	0.958	cellular response to organic substance
GO:0008219	0.943	cell death
GO:0007005	0.935	mitochondrion organization
GO:0007165	0.935	signal transduction
GO:2001234	0.932	negative regulation of apoptotic signaling pathway
GO:0006950	0.931	response to stress
GO:0009719	0.930	response to endogenous stimulus
GO:0032501	0.926	multicellular organismal process
GO:1901700	0.919	response to oxygen-containing compound
GO:0009893	0.910	positive regulation of metabolic process
GO:0097190	0.910	apoptotic signaling pathway
GO:0048856	0.908	anatomical structure development
GO:0010243	0.902	response to organonitrogen compound
GO:0051128	0.898	regulation of cellular component organization
GO:0033554	0.885	cellular response to stress
GO:0031323	0.861	regulation of cellular metabolic process
GO:0065008	0.857	regulation of biological quality
GO:0060255	0.856	regulation of macromolecule metabolic process
GO:0034097	0.850	response to cytokine
GO:0002931	0.849	response to ischemia
GO:0051171	0.847	regulation of nitrogen compound metabolic process
GO:0051179	0.846	localization
GO:0071495	0.842	cellular response to endogenous stimulus
GO:0097191	0.832	extrinsic apoptotic signaling pathway
GO:0007275	0.831	multicellular organism development
GO:1901701	0.829	cellular response to oxygen-containing compound
GO:0009605	0.817	response to external stimulus
GO:0010942	0.801	positive regulation of cell death
GO:0080090	0.800	regulation of primary metabolic process
GO:0051234	0.794	establishment of localization
GO:0051641	0.792	cellular localization
GO:0044419	0.790	biological process involved in interspecies interaction between organisms
GO:0014070	0.788	response to organic cyclic compound
GO:0043065	0.769	positive regulation of apoptotic process
GO:0051649	0.762	establishment of localization in cell
GO:0009892	0.758	negative regulation of metabolic process
GO:0048731	0.756	system development
GO:0009607	0.753	response to biotic stimulus
GO:0051049	0.746	regulation of transport
GO:0035556	0.744	intracellular signal transduction
GO:1902531	0.739	regulation of intracellular signal transduction
GO:0065009	0.724	regulation of molecular function
GO:0009628	0.723	response to abiotic stimulus
GO:0051246	0.722	regulation of protein metabolic process
GO:0050790	0.709	regulation of catalytic activity
GO:0006810	0.709	transport
GO:0031324	0.703	negative regulation of cellular metabolic process
GO:2001242	0.703	regulation of intrinsic apoptotic signaling pathway
GO:0010605	0.692	negative regulation of macromolecule metabolic process
GO:0030154	0.689	cell differentiation
GO:0048513	0.680	animal organ development
GO:1901699	0.680	cellular response to nitrogen compound
GO:0051172	0.673	negative regulation of nitrogen compound metabolic process
GO:0000003	0.670	reproduction
GO:0006839	0.632	mitochondrial transport
GO:0045137	0.630	development of primary sexual characteristics
GO:0010604	0.616	positive regulation of macromolecule metabolic process
GO:0009615	0.614	response to virus
GO:0008637	0.613	apoptotic mitochondrial changes
GO:0008406	0.612	gonad development
GO:0071417	0.584	cellular response to organonitrogen compound
GO:0008152	0.578	metabolic process
GO:0090559	0.567	regulation of membrane permeability
GO:0046660	0.561	female sex differentiation
GO:2001243	0.556	negative regulation of intrinsic apoptotic signaling pathway
GO:0046902	0.555	regulation of mitochondrial membrane permeability
GO:0008585	0.543	female gonad development
GO:1901654	0.538	response to ketone
GO:0019219	0.528	regulation of nucleobase-containing compound metabolic process
GO:0001541	0.528	ovarian follicle development
GO:0023056	0.509	positive regulation of signaling
GO:0048584	0.505	positive regulation of response to stimulus
GO:0010647	0.493	positive regulation of cell communication
GO:0051173	0.484	positive regulation of nitrogen compound metabolic process
GO:0031325	0.457	positive regulation of cellular metabolic process
GO:0031326	0.454	regulation of cellular biosynthetic process
GO:0080134	0.452	regulation of response to stress
GO:0042592	0.436	homeostatic process
GO:0051129	0.435	negative regulation of cellular component organization
GO:1901653	0.433	cellular response to peptide
GO:0042127	0.416	regulation of cell population proliferation
GO:0071704	0.400	organic substance metabolic process
GO:0010468	0.382	regulation of gene expression
GO:0071407	0.382	cellular response to organic cyclic compound
GO:0010035	0.373	response to inorganic substance
GO:0033993	0.371	response to lipid
GO:0044237	0.350	cellular metabolic process
GO:0007420	0.342	brain development
GO:0019220	0.312	regulation of phosphate metabolic process
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031090	1.000	organelle membrane
GO:0005739	1.000	mitochondrion
GO:0031967	0.999	organelle envelope
GO:0098588	0.992	bounding membrane of organelle
GO:0005740	0.990	mitochondrial envelope
GO:0012505	0.987	endomembrane system
GO:0019867	0.985	outer membrane
GO:0031966	0.984	mitochondrial membrane
GO:0005741	0.969	mitochondrial outer membrane
GO:0005634	0.848	nucleus
GO:0070013	0.718	intracellular organelle lumen
GO:0032991	0.355	protein-containing complex
GO:0043232	0.315	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]