StarFunc result for job id Q07820

User Input

>input (350 residues)
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07820	1.000	1.000	3.202E-42	350	1.000	1.000	Q07820.pdb.gz	MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=3
2	AFDB:P97287	0.556	0.586	9.875E-30	331	0.760	0.804	P97287.pdb.gz	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
3	PDB:4wmuA	0.418	0.284	4.004E-17	516	0.414	0.281	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
4	PDB:5w62A	0.351	0.723	3.508E-4	156	0.117	0.263	5w62A.pdb.gz
5	PDB:2k7wA	0.384	0.641	7.860E-4	192	0.114	0.208	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
6	PDB:1lxlA	0.336	0.513	1.096E-3	221	0.103	0.163	1lxlA.pdb.gz
7	PDB:1bxlA	0.336	0.597	1.149E-3	181	0.100	0.193	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
8	PDB:1o0lA	0.360	0.611	7.668E-3	188	0.106	0.197	1o0lA.pdb.gz
9	PDB:7cclC	0.212	0.417	4.438E-2	147	0.077	0.184	7cclC.pdb.gz
10	AFDB:A0A0B4LFI1	0.109	0.047	8.317E-2	1089	0.117	0.038	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
11	AFDB:A0A0B4LFF3	0.106	0.048	2.362E-1	936	0.129	0.048	A0A0B4LFF3.pdb.gz	A0A0B4LFF3_DROME Stac-like, isoform P OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	PDB:2vvyA	0.241	0.498	2.825E-1	142	0.040	0.099	2vvyA.pdb.gz
13	AFDB:Q8IJS7	0.098	0.044	3.141E-1	1139	0.074	0.023	Q8IJS7.pdb.gz	Q8IJS7_PLAF7 PRE-binding protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1011800 PE=4 SV=1
14	AFDB:Q63767	0.125	0.062	3.621E-1	968	0.149	0.054	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
15	AFDB:A0A024QZV9	0.136	0.067	3.982E-1	834	0.146	0.061	A0A024QZV9.pdb.gz
16	AFDB:O88387	0.132	0.076	6.400E-1	766	0.123	0.056	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
17	AFDB:Q12912	0.098	0.065	6.400E-1	555	0.149	0.094	Q12912.pdb.gz	IRAG2_HUMAN Inositol 1,4,5-triphosphate receptor associated 2 OS=Homo sapiens OX=9606 GN=IRAG2 PE=1 SV=3
18	PDB:6z5lA	0.186	0.235	7.297E-1	251	0.074	0.104	6z5lA.pdb.gz
19	AFDB:Q57X11	0.101	0.055	7.737E-1	918	0.151	0.058	Q57X11.pdb.gz	Q57X11_TRYB2 Recombination initiation protein NBS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.400 PE=4 SV=1
20	PDB:3ciuC	0.095	0.155	8.823E-1	141	0.049	0.121	3ciuC.pdb.gz	Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07820	0.0	701	350	1.000	1.000	MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=3
2	P97287	3.76e-166	468	331	0.760	0.804	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
3	Q9Z1P3	5.29e-162	457	330	0.754	0.800	MCL1_RAT Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Rattus norvegicus OX=10116 GN=Mcl1 PE=1 SV=2
4	A0A087WT64	5.87e-115	333	197	0.463	0.822	A0A087WT64_HUMAN MCL1 apoptosis regulator, BCL2 family member OS=Homo sapiens OX=9606 GN=MCL1 PE=1 SV=1
5	Q9I9N3	8.25e-52	174	255	0.274	0.376	Q9I9N3_DANRE Cell death regulator Mcl-1a OS=Danio rerio OX=7955 GN=zgc:109835 PE=2 SV=1
6	Q568W5	2.78e-41	146	228	0.246	0.377	Q568W5_DANRE MCL1 apoptosis regulator, BCL2 family member b OS=Danio rerio OX=7955 GN=zgc:109763 PE=2 SV=1
7	Q8UWD5	2.78e-18	83.6	176	0.171	0.341	Q8UWD5_DANRE BCL2-like 10 OS=Danio rerio OX=7955 GN=NR-13 PE=1 SV=1
8	P10417	2.24e-10	62.4	236	0.109	0.161	BCL2_MOUSE Apoptosis regulator Bcl-2 OS=Mus musculus OX=10090 GN=Bcl2 PE=1 SV=3
9	P49950	3.15e-10	62.0	236	0.109	0.161	BCL2_RAT Apoptosis regulator Bcl-2 OS=Rattus norvegicus OX=10116 GN=Bcl2 PE=1 SV=2
10	Q07812	5.82e-10	60.5	192	0.117	0.214	BAX_HUMAN Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1
11	Q564A4	1.00e-09	60.5	228	0.097	0.149	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
12	A0A0D9S330	1.40e-09	59.3	192	0.114	0.208	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
13	O02718	1.58e-09	59.7	229	0.109	0.166	BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
14	Q63690	2.39e-09	58.5	192	0.117	0.214	BAX_RAT Apoptosis regulator BAX OS=Rattus norvegicus OX=10116 GN=Bax PE=1 SV=2
15	Q00709	2.73e-09	58.9	233	0.097	0.146	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
16	P10415	3.09e-09	58.9	239	0.106	0.155	BCL2_HUMAN Apoptosis regulator Bcl-2 OS=Homo sapiens OX=9606 GN=BCL2 PE=1 SV=2
17	Q07813	5.34e-09	57.4	192	0.114	0.208	BAX_MOUSE Apoptosis regulator BAX OS=Mus musculus OX=10090 GN=Bax PE=1 SV=1
18	Q07440	8.40e-09	56.6	172	0.097	0.198	B2LA1_MOUSE Bcl-2-related protein A1 OS=Mus musculus OX=10090 GN=Bcl2a1 PE=1 SV=1
19	Q90Z98	1.83e-08	56.6	238	0.100	0.147	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
20	Q16611	2.17e-08	56.2	211	0.114	0.190	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	1.7e-21	88.1	Apoptosis regulator proteins, Bcl-2 family
2	PF15286 Bcl-2_3	1.1e+02	14.9	Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326119	0.999	Phorbol-12-myristate-13-acetate-induced protein 1
2	9606.ENSP00000376943	0.999	Bcl-2-like protein 11
3	9606.ENSP00000293288	0.998	Apoptosis regulator BAX
4	9606.ENSP00000340648	0.998	E3 ubiquitin-protein ligase HUWE1
5	9606.ENSP00000404503	0.997	Bcl-2-binding component 3
6	9606.ENSP00000269305	0.995	Cellular tumor antigen p53
7	9606.ENSP00000355231	0.995	Beclin-1
8	9606.ENSP00000363591	0.994	Bcl-2 homologous antagonist/killer
9	9606.ENSP00000384924	0.991	Protein Bop
10	9606.ENSP00000318822	0.990	BH3-interacting domain death agonist
11	9606.ENSP00000281708	0.984	F-box/WD repeat-containing protein 7
12	9606.ENSP00000316357	0.980	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
13	9606.ENSP00000306253	0.979	Inositol 1,4,5-trisphosphate receptor type 1
14	9606.ENSP00000264657	0.977	Signal transducer and activator of transcription 3
15	9606.ENSP00000314132	0.976	Bcl-2-related ovarian killer protein
16	9606.ENSP00000346697	0.976	Bcl-2-modifying factor
17	9606.ENSP00000451828	0.975	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000265333	0.971	Voltage-dependent anion-selective channel protein 1
19	9606.ENSP00000302564	0.966	Bcl-2-like protein 1
20	9606.ENSP00000216115	0.965	Bcl-2-interacting killer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051400	1.000	BH domain binding
GO:0008320	1.000	protein transmembrane transporter activity
GO:0046982	0.996	protein heterodimerization activity
GO:0051434	0.714	BH3 domain binding
GO:0042802	0.634	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0043066	0.993	negative regulation of apoptotic process
GO:0050896	0.990	response to stimulus
GO:0009987	0.990	cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.973	positive regulation of cellular process
GO:0007165	0.966	signal transduction
GO:0006915	0.915	apoptotic process
GO:0097190	0.904	apoptotic signaling pathway
GO:0048583	0.896	regulation of response to stimulus
GO:0009892	0.895	negative regulation of metabolic process
GO:1903201	0.888	regulation of oxidative stress-induced cell death
GO:1902533	0.880	positive regulation of intracellular signal transduction
GO:1903203	0.868	regulation of oxidative stress-induced neuron death
GO:0031323	0.866	regulation of cellular metabolic process
GO:0007166	0.863	cell surface receptor signaling pathway
GO:0043065	0.837	positive regulation of apoptotic process
GO:2001233	0.805	regulation of apoptotic signaling pathway
GO:2001242	0.738	regulation of intrinsic apoptotic signaling pathway
GO:0060255	0.719	regulation of macromolecule metabolic process
GO:2001236	0.717	regulation of extrinsic apoptotic signaling pathway
GO:0080090	0.694	regulation of primary metabolic process
GO:0097191	0.681	extrinsic apoptotic signaling pathway
GO:0042221	0.674	response to chemical
GO:2001235	0.670	positive regulation of apoptotic signaling pathway
GO:0023057	0.655	negative regulation of signaling
GO:0051171	0.653	regulation of nitrogen compound metabolic process
GO:2001244	0.630	positive regulation of intrinsic apoptotic signaling pathway
GO:0048585	0.628	negative regulation of response to stimulus
GO:0043523	0.600	regulation of neuron apoptotic process
GO:1901216	0.592	positive regulation of neuron death
GO:0043525	0.564	positive regulation of neuron apoptotic process
GO:0009894	0.541	regulation of catabolic process
GO:0010033	0.488	response to organic substance
GO:2001239	0.480	regulation of extrinsic apoptotic signaling pathway in absence of ligand
GO:0031324	0.459	negative regulation of cellular metabolic process
GO:0009968	0.440	negative regulation of signal transduction
GO:0006950	0.438	response to stress
GO:0031329	0.399	regulation of cellular catabolic process
GO:0009893	0.378	positive regulation of metabolic process
GO:0008152	0.338	metabolic process
GO:0051246	0.330	regulation of protein metabolic process
GO:0065009	0.327	regulation of molecular function
GO:2001234	0.321	negative regulation of apoptotic signaling pathway
GO:0050790	0.309	regulation of catalytic activity
GO:0070887	0.308	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005739	1.000	mitochondrion
GO:0031090	0.975	organelle membrane
GO:0032991	0.973	protein-containing complex
GO:0031967	0.928	organelle envelope
GO:0098588	0.848	bounding membrane of organelle
GO:0005740	0.837	mitochondrial envelope
GO:0019867	0.799	outer membrane
GO:0031966	0.741	mitochondrial membrane
GO:0031968	0.725	organelle outer membrane
GO:0005741	0.709	mitochondrial outer membrane
GO:0070013	0.487	intracellular organelle lumen
GO:0097136	0.465	Bcl-2 family protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]