StarFunc result for job id Q07837

User Input

>input (685 residues)
MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRGILGSQEPDFK
GVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQE
GPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDF
REVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRTRTGKYTDYYIWH
DCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEIL
RFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDFTTTQVGMHDI
VRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLSMLDTVS
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNQYVNVMNMLLFTLPGTPITYY
GEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDV
QKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFG
ESTLLNLHNMISGLPAKMRIRLSTNSADKGSKVDTSGIFLDKGEGLIFEHNTKNLLHRQT
AFRDRCFVSNRACYSSVLNILYTSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6li9A	0.875	0.961	0.000	623	0.909	1.000	6li9A.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
2	AFDB:Q07837	1.000	1.000	0.000	685	1.000	1.000	Q07837.pdb.gz	SLC31_HUMAN Amino acid transporter heavy chain SLC3A1 OS=Homo sapiens OX=9606 GN=SLC3A1 PE=1 SV=2
3	AFDB:Q91WV7	0.901	0.901	0.000	685	0.801	0.801	Q91WV7.pdb.gz	SLC31_MOUSE Amino acid transporter heavy chain SLC3A1 OS=Mus musculus OX=10090 GN=Slc3a1 PE=1 SV=1
4	AFDB:Q9P6J3	0.707	0.831	8.354E-46	579	0.238	0.282	Q9P6J3.pdb.gz	MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mal1 PE=2 SV=1
5	AFDB:P28904	0.682	0.840	1.309E-45	551	0.223	0.278	P28904.pdb.gz	TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=treC PE=1 SV=3
6	AFDB:A0A1D8PP39	0.681	0.795	5.637E-45	582	0.242	0.285	A0A1D8PP39.pdb.gz	A0A1D8PP39_CANAL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C504940WA PE=4 SV=1
7	AFDB:A0A1D8PUB9	0.688	0.820	2.295E-44	570	0.250	0.300	A0A1D8PUB9.pdb.gz	A0A1D8PUB9_CANAL Oligo-1,6-glucosidase IMA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAL2 PE=4 SV=1
8	AFDB:O45298	0.632	0.668	3.039E-44	647	0.242	0.257	O45298.pdb.gz	O45298_CAEEL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgp-2 PE=1 SV=2
9	AFDB:D9MPF2	0.681	0.774	5.961E-44	600	0.244	0.278	D9MPF2.pdb.gz	D9MPF2_ERWRD Sucrose isomerase OS=Erwinia rhapontici OX=55212 PE=1 SV=2
10	AFDB:C8V523	0.693	0.805	7.055E-44	585	0.219	0.256	C8V523.pdb.gz	C8V523_EMENI Maltase MalT (AFU_orthologue AFUA_8G07070) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10420 PE=4 SV=1
11	PDB:4howA	0.690	0.839	4.533E-43	559	0.235	0.288	4howA.pdb.gz	The Structural Basis of Erwinia rhapontici Isomaltulose Synthase
12	PDB:3a47A	0.686	0.797	2.443E-42	586	0.229	0.268	3a47A.pdb.gz	Crystal structure of isomaltase from Saccharomyces cerevisiae
13	AFDB:P0CW40	0.694	0.802	2.566E-42	589	0.226	0.263	P0CW40.pdb.gz	MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA3 PE=1 SV=1
14	PDB:5jy7B	0.624	0.739	3.422E-42	571	0.248	0.298	5jy7B.pdb.gz	Crystal structure of the TreS-Pep2 complex, initiating alpha-glucan synthesis in the GlgE pathway of mycobacteria.
15	PDB:7dskA	0.513	0.726	1.944E-27	471	0.190	0.276	7dskA.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
16	PDB:3k8kA	0.556	0.584	6.686E-27	650	0.185	0.195	3k8kA.pdb.gz	SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
17	PDB:1j0hA	0.508	0.586	1.467E-25	588	0.162	0.189	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
18	PDB:7vt9A	0.509	0.573	1.107E-21	604	0.142	0.161	7vt9A.pdb.gz
19	PDB:1ea9C	0.511	0.594	8.356E-21	583	0.140	0.165	1ea9C.pdb.gz
20	PDB:6s9vB	0.437	0.590	7.458E-16	492	0.117	0.163	6s9vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07837	0.0	1437	685	1.000	1.000	SLC31_HUMAN Amino acid transporter heavy chain SLC3A1 OS=Homo sapiens OX=9606 GN=SLC3A1 PE=1 SV=2
2	Q64319	0.0	1153	683	0.797	0.799	SLC31_RAT Amino acid transporter heavy chain SLC3A1 OS=Rattus norvegicus OX=10116 GN=Slc3a1 PE=1 SV=1
3	Q91WV7	0.0	1176	685	0.804	0.804	SLC31_MOUSE Amino acid transporter heavy chain SLC3A1 OS=Mus musculus OX=10090 GN=Slc3a1 PE=1 SV=1
4	A0R6E0	6.90e-71	243	593	0.253	0.292	TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=treS PE=1 SV=1
5	P28904	1.53e-70	241	551	0.225	0.279	TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=treC PE=1 SV=3
6	Q9P6J3	6.19e-70	240	579	0.238	0.282	MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mal1 PE=2 SV=1
7	A0A1D8PUB9	7.58e-70	240	570	0.255	0.307	A0A1D8PUB9_CANAL Oligo-1,6-glucosidase IMA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAL2 PE=4 SV=1
8	D9MPF2	1.13e-67	234	600	0.229	0.262	D9MPF2_ERWRD Sucrose isomerase OS=Erwinia rhapontici OX=55212 PE=1 SV=2
9	P9WQ19	4.75e-67	233	601	0.244	0.278	TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=treS PE=1 SV=1
10	O53198	1.08e-62	220	546	0.210	0.264	O53198_MYCTU Probable alpha-glucosidase AglA (Maltase) (Glucoinvertase) (Glucosidosucrase) (Maltase-glucoamylase) (Lysosomal alpha-glucosidase) (Acid maltase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aglA PE=1 SV=1
11	A0A1D8PP39	3.29e-62	219	582	0.220	0.259	A0A1D8PP39_CANAL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C504940WA PE=4 SV=1
12	C8V523	3.06e-55	200	585	0.229	0.268	C8V523_EMENI Maltase MalT (AFU_orthologue AFUA_8G07070) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10420 PE=4 SV=1
13	P53051	5.42e-52	191	589	0.222	0.258	MALX3_YEAST Oligo-1,6-glucosidase IMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA1 PE=1 SV=1
14	P53341	6.99e-52	191	584	0.232	0.272	MAL12_YEAST Alpha-glucosidase MAL12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAL12 PE=1 SV=1
15	P38158	1.24e-51	190	584	0.232	0.272	MAL32_YEAST Alpha-glucosidase MAL32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAL32 PE=1 SV=1
16	O45298	6.94e-50	186	647	0.253	0.267	O45298_CAEEL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgp-2 PE=1 SV=2
17	P0CW40	1.89e-49	184	589	0.143	0.166	MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA3 PE=1 SV=1
18	P0CW41	1.89e-49	184	589	0.143	0.166	MALX4_YEAST Oligo-1,6-glucosidase IMA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA4 PE=3 SV=1
19	Q08295	6.22e-49	183	589	0.143	0.166	IMA2_YEAST Oligo-1,6-glucosidase IMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA2 PE=2 SV=1
20	P40884	1.04e-47	179	581	0.210	0.248	IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMA5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00128 Alpha-amylase	7.5e-83	290.5	Alpha amylase, catalytic domain
2	PF16028 SLC3A2_N	0.5	21.4	Solute carrier family 3 member 2 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000023064	0.999	B(0,+)-type amino acid transporter 1
2	9606.ENSP00000386543	0.916	Prolyl endopeptidase-like
3	9606.ENSP00000367755	0.907	Calmodulin-lysine N-methyltransferase
4	9606.ENSP00000282412	0.906	Protein phosphatase 1B
5	9606.ENSP00000478639	0.856	Amino acid transporter
6	9606.ENSP00000297524	0.854	Solute carrier family 7 member 13
7	9606.ENSP00000262352	0.813	Excitatory amino acid transporter 3
8	9606.ENSP00000380666	0.806	Y+L amino acid transporter 1
9	9606.ENSP00000455064	0.787	Y+L amino acid transporter 2
10	9606.ENSP00000320378	0.775	Large neutral amino acids transporter small subunit 2
11	9606.ENSP00000261622	0.753	Large neutral amino acids transporter small subunit 1
12	9606.ENSP00000305302	0.749	Sodium-dependent neutral amino acid transporter B(0)AT1
13	9606.ENSP00000280612	0.743	Cystine/glutamate transporter
14	9606.ENSP00000278379	0.723	Excitatory amino acid transporter 2
15	9606.ENSP00000365686	0.706	Solute carrier family 15 member 1
16	9606.ENSP00000252660	0.700	Proto-oncogene Mas
17	9606.ENSP00000265113	0.700	Excitatory amino acid transporter 1
18	9606.ENSP00000221742	0.680	Excitatory amino acid transporter 4
19	9606.ENSP00000234256	0.670	Neutral amino acid transporter A
20	9606.ENSP00000359680	0.655	4-hydroxy-2-oxoglutarate aldolase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:0005342	1.000	organic acid transmembrane transporter activity
GO:1901682	0.999	sulfur compound transmembrane transporter activity
GO:0015179	0.987	L-amino acid transmembrane transporter activity
GO:0072349	0.890	modified amino acid transmembrane transporter activity
GO:0000099	0.872	sulfur amino acid transmembrane transporter activity
GO:0015174	0.830	basic amino acid transmembrane transporter activity
GO:0003824	0.763	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071702	0.995	organic substance transport
GO:0015711	0.991	organic anion transport
GO:0015849	0.990	organic acid transport
GO:0006865	0.981	amino acid transport
GO:0072348	0.934	sulfur compound transport
GO:0072337	0.867	modified amino acid transport
GO:0015804	0.793	neutral amino acid transport
GO:0009987	0.773	cellular process
GO:0015807	0.702	L-amino acid transport
GO:0008152	0.379	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0005737	0.988	cytoplasm
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0005576	0.976	extracellular region
GO:0098590	0.976	plasma membrane region
GO:0031982	0.933	vesicle
GO:0065010	0.914	extracellular membrane-bounded organelle
GO:0070062	0.903	extracellular exosome
GO:0120025	0.825	plasma membrane bounded cell projection
GO:0031526	0.756	brush border membrane
GO:0031090	0.665	organelle membrane
GO:0012505	0.471	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]